Difference between revisions of "Os11g0249000"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(Function)
Line 11: Line 11:
  
 
===Function===
 
===Function===
NLS1 displays spontaneous lesions, specifically on leaf sheaths, with a developmental pattern. nls1-1D plants also exhibited constitutively activated defense responses, including extensive cell death, excess hydrogen peroxide and salicylic acid (SA) accumulation, up-regulated expressions of pathogenesis-related genes, and enhanced resistance to bacterial pathogens.NLS1 encodes a typical CC-NB-LRR-type protein in rice and causes a S367N substitution in the non-conserved region close to the GLPL motif of the NB domain
+
NLS1 displays spontaneous lesions, specifically on leaf sheaths, with a developmental pattern. nls1-1D plants also exhibited constitutively activated defense responses, including extensive cell death, excess hydrogen peroxide and salicylic acid (SA) accumulation, up-regulated expressions of pathogenesis-related genes, and enhanced resistance to bacterial pathogens.NLS1 encodes a typical CC-NB-LRR-type protein in rice and causes a S367N substitution in the non-conserved region close to the GLPL motif of the NB domain. An adjacent S366T substitution was found in another semi-dominant mutant, nls1-2D, which exhibited the same phenotypes as nls1-1D. Combined analyses of wild-type plants transformed with the mutant NLS1 gene (nls1-1D), NLS1 RNAi and over-expression transgenic lines showed that nls1-2D is allelic to nls1-1D, and both mutations may cause constitutive auto-activation of the NLS1 R protein. Further real-time PCR analysis revealed that NLS1 is expressed constitutively in an age-dependent manner. In addition, because the morphology and constitutive defense responses of nls1-1D were not suppressed by blocking SA or NPR1 transcript accumulation, we suggest that NLS1 mediates both SA and NPR1-independent defense signaling pathways in rice.
  
 
===Expression===
 
===Expression===

Revision as of 15:00, 1 June 2014

Please input one-sentence summary here.

Annotated Information

Introduction

One of the main defense mechanisms is resistance (R) gene-mediated disease resistance. The majority of R genes characterized encode proteins that have a central nucleotide-binding region (NB) plus a C- terminal leucine-rich repeat (LRR).The NB-LRR proteins recognize the corresponding avirulence (Avr) effectors produced by the pathogen and activate defense responses. In most cases, these defense responses are accompanied by a hypersensitivity response (HR) in the infected cells, triggering the rapid production of reactive oxygen species (ROS).These defense responses are also associated with accumulation of salicylic acid (SA), which functions in the induction of numerous pathogenesis-related (PR) genes, and the establishment of systemic acquired resistance (SAR).SA is required in R gene-mediated defense signaling pathways. It is assumed that R proteins are present in an auto-inhibited state and are unable to activate defense responses in the absence of pathogens. Here, we describe the semi-dominant rice mutant nls1-1D ( necrotic leaf sheath 1 ), which displayed tissue-specific and age-dependent spontaneous necrotic lesions and defense-related phenotypes.

Keywords: NLS1, CC-NB-LRR, disease resistance protein, lesion, salicylic acid, rice.

Function

NLS1 displays spontaneous lesions, specifically on leaf sheaths, with a developmental pattern. nls1-1D plants also exhibited constitutively activated defense responses, including extensive cell death, excess hydrogen peroxide and salicylic acid (SA) accumulation, up-regulated expressions of pathogenesis-related genes, and enhanced resistance to bacterial pathogens.NLS1 encodes a typical CC-NB-LRR-type protein in rice and causes a S367N substitution in the non-conserved region close to the GLPL motif of the NB domain. An adjacent S366T substitution was found in another semi-dominant mutant, nls1-2D, which exhibited the same phenotypes as nls1-1D. Combined analyses of wild-type plants transformed with the mutant NLS1 gene (nls1-1D), NLS1 RNAi and over-expression transgenic lines showed that nls1-2D is allelic to nls1-1D, and both mutations may cause constitutive auto-activation of the NLS1 R protein. Further real-time PCR analysis revealed that NLS1 is expressed constitutively in an age-dependent manner. In addition, because the morphology and constitutive defense responses of nls1-1D were not suppressed by blocking SA or NPR1 transcript accumulation, we suggest that NLS1 mediates both SA and NPR1-independent defense signaling pathways in rice.

Expression

NLS1 encodes a typical CC-NB-LRR-type protein in rice and causes a S367N substitution in the non-conserved region close to the GLPL motif of the NB domain

Evolution

In recent years, some reports have shown that R protein mutations are sufficient to cause pathogen-independent defense responses; for example, single amino acid substitutions in the TIR-NB-LRR-type R proteins SSI4 and SNC1 and the CC-NB-LRR-type R protein UNI all cause constitutive expression of defense responses in Arabidopsis (Shirano et al., 2002; Zhang et al., 2003; Noutoshi et al., 2005; Igari et al., 2008). Furthermore, a single amino acid insertion in the WRKY domain of Arabidopsis SLH1, a TIR-NB-LRR-WRKY-type R protein, also activates pathogen-independent defense responses (Noutoshi et al., 2005). In addition, modifications to the coding sequences of some CC-NB-LRR-type R genes, such as the tomato (Lycopersicon esculentum) Mi gene,the potato (Solanum tuberosum) Rx gene and the maize(Zea mays) Rp1 gene, often result in mutants with constitutive defense activity (Hulbert, 1997; Hwang et al., 2000;Bendahmane et al., 2002). On the other hand, several other studies have demonstrated that over-expression of R genes,for example Arabidopsis At4g16890 (SNC1) or tomato Pto or Prf, results in pathogen-independent resistance responses.Recently, it has been shown that constitutive expression of the Arabidopsis CC-NB-LRR-type R gene ADR1, caused by the insertion of CaMV 35S enhancers 4 kb upstream of its promoter, also leads to a constitutive defense phenotype .

Summary

In this study, we characterized the semi-dominant mutant nls1-1D (necrotic leaf sheath 1) of rice, which displays spontaneous lesions, specifically on leaf sheaths, with a developmental pattern. nls1-1D plants also exhibited constitutively activated defense responses, including extensive cell death, excess hydrogen peroxide and salicylic acid (SA) accumulation, up-regulated expressions of pathogenesis-related genes, and enhanced resistance to bacterial pathogens. Map-based cloning revealed that NLS1 encodes a typical CC-NB-LRR-type protein in rice. The nls1-1D mutation causes a S367N substitution in the non-conserved region close to the GLPL motif of the NB domain. An adjacent S366T substitution was found in another semi-dominant mutant, nls1-2D, which exhibited the same phenotypes as nls1-1D. Combined analyses of wild-type plants transformed with the mutant NLS1 gene (nls1-1D), NLS1 RNAi and over-expression transgenic lines showed that nls1-2D is allelic to nls1-1D, and both mutations may cause constitutive auto-activation of the NLS1 R protein. Further real-time PCR analysis revealed that NLS1 is expressed constitutively in an age-dependent manner. In addition, because the morphology and constitutive defense responses of nls1-1D were not suppressed by blocking SA or NPR1 transcript accumulation, we suggest that NLS1 mediates both SA and NPR1-independent defense signaling pathways in rice.

Labs working on this gene

State Key Laboratory of Plant Genomics and National Center for Plant Gene Research (Beijing), Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China,

Graduate School of the Chinese Academy of Sciences, Beijing 100101, China, and

China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou 310006, China

References

Please input cited references here.

Structured Information

Gene Name

Os11g0249000

Description

Disease resistance protein family protein

Version

NM_001074150.1 GI:115484948 GeneID:4350204

Length

5550 bp

Definition

Oryza sativa Japonica Group Os11g0249000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 11

Location

Chromosome 11:8074465..8080014

Sequence Coding Region

8074504..8075291,8077897..8079865

Expression

GEO Profiles:Os11g0249000

Genome Context

<gbrowseImage1> name=NC_008404:8074465..8080014 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008404:8074465..8080014 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggaagcagcgatagtgagtgcttcgacgggagtgatgcgttccctcctcgccaagctcacaaaccttcttggtggtgagtacaagctacttaagtggctccgtagggagatggagttcctcgagagcgagctccgtagcatgagcatcttcttggagaggttggaggacacgcaaaagcttcacccccaaatgaaggattggagggatcgagtacgcgagttggcatacgacattgaggattgcatcgacgacttcatactacagcttgattccaaggatgcgaaggttgggtttgggcaaaagcttcttgcatcccgtaggattggccacatgattcgagaactcaaggcgcgtgtaatggaggagagtgagagacaaaggaggtacatgcttgatggcttggcatctgggcctagtgttcgtgtgaaggttgatccacggctatcggctctctatgtcgacgaggacagattagttggtattgatgccccgagagatgagatcattgggcggctgttggacaagcggagaagtgcctcagcaaaacaggtcatgacaatttccatcgtgggttgcggaggattggggaagaccacccttgccaatcaaatttactgcaaaatcaaaggaaaatttgagtgcgcagcttttgcgtcagtgttccaaaatcccaacaccaagaaggttttgacgaatattctttcccaagtggccactactgctgctgtggaagacgatgagcaagccatcatcaacaagctaagggaataccttagtgacaagaggtacattgtcatagttgatgatatatgggatatgcaaatatggaaatttattgaatgtgcgttggtcaagaactgccgtggtagcagaattatcacaacaacacgtatacatgatattgctaaattgtgctgttcatctcatggcgattatatttacgaaatgaagcctcttggagttattgactccaaaatattgttcgacaaaagaatttttgatccagaggaaaggcgcccaccgcagttgacagaagtttctgaggaaatattgaaaaaatgtggtggtttgcctttggcgatcatttccatatcaagtttgttggcaagcaaaccaaagtcaaaagatcaatgggacagggtcaaggtttctcttagctctacgcttgaaaggactccagacattgaaaccatggaatgggtgctatcactcagttactctgatcttcctaatcatttaaaaacatgtctgttatatttgagtatattccctgagggctatgagataaacagggaacgtttggtgagtagatggattgctgaaggattcatttacaaaaaacatggacaaaatccatatgaagtgggggacagttattttaatgagcttgtgaacagaagcttgattcaaccagcaaacattaagcctgatggtcagacaaatgcttgtcgagtggatgacaccgttcatgattttattgtgtccatgtcagttgaagaaaatttcgttacattatttggtggttcaaaattggtaccaaggtcacatggtaaggttcgtcgattatctattcaaaatggcggcattcaagaaaatattgtcacatcaacgcacttggttacatcgcaagtccggtcactaactttatttgctgtagaaatgccatctcttttaggttttggtatgttacgtgtattggacctagaagattgttatgcattagaagaccatcatcttacgaacctggaaaggctagtccagttacggtatttgagtataagaacatcacccattagtgaactcccgaaacaaattgggcagcttcaatatctggaaacactagatttaagagctacgggtgtggaagaattgccatcaaccattggtagactaaagagtttggtccgtttattcgttgattatcatgttaaattaccaaaagaaatcagcaatatgcatgcactggaagagctaacaagtttctcagccttgatgtactctccagactttctgaaagaactaggtcagcttacaaacatgagggtgctccgagtaatttgtgactgtgatagctttaaaggtgatgcaggaagttgcttggaaaatttagcttcttctttatgtaatctaggcacatataaccttcattccctttttgttgacatcaatggatatggtgaagacaacttctcactagatacatggcaacctgttccatctagactaagaagattttccattgaccggtggtgccccatcaataagattccgaattgggtgggttcactgatcaaccttgaagagttagtcctatatgtcaacaaaatttggcaggaggatttcgaattgctaggacatatgcctgctctgtcatctctgaccatatactcaaatactgcccttcaagggaggatcatcatcagtggattccattctaccaagtttttcaagttctattgcaatcctgcagggttaacctttgacgcaggaagtctgttaaagctcgaatgccttgatgtcataatgaatgtgttcaacacgaagtcttcaaatggtagctttgattttggcattcaatatcttaccaaccttagaaatgtctacattcaacttgattgtaatgggtcgactggtggagaattggaagcagctaaagcttccatcaagagctcagtaaacaaacttccaggacagcctaagctgaacttgagcacattgaatgaaaatatgttagtccatgaagaagctaattaa</cdnaseq>

Protein Sequence

<aaseq>MEAAIVSASTGVMRSLLAKLTNLLGGEYKLLKWLRREMEFLESE LRSMSIFLERLEDTQKLHPQMKDWRDRVRELAYDIEDCIDDFILQLDSKDAKVGFGQK LLASRRIGHMIRELKARVMEESERQRRYMLDGLASGPSVRVKVDPRLSALYVDEDRLV GIDAPRDEIIGRLLDKRRSASAKQVMTISIVGCGGLGKTTLANQIYCKIKGKFECAAF ASVFQNPNTKKVLTNILSQVATTAAVEDDEQAIINKLREYLSDKRYIVIVDDIWDMQI WKFIECALVKNCRGSRIITTTRIHDIAKLCCSSHGDYIYEMKPLGVIDSKILFDKRIF DPEERRPPQLTEVSEEILKKCGGLPLAIISISSLLASKPKSKDQWDRVKVSLSSTLER TPDIETMEWVLSLSYSDLPNHLKTCLLYLSIFPEGYEINRERLVSRWIAEGFIYKKHG QNPYEVGDSYFNELVNRSLIQPANIKPDGQTNACRVDDTVHDFIVSMSVEENFVTLFG GSKLVPRSHGKVRRLSIQNGGIQENIVTSTHLVTSQVRSLTLFAVEMPSLLGFGMLRV LDLEDCYALEDHHLTNLERLVQLRYLSIRTSPISELPKQIGQLQYLETLDLRATGVEE LPSTIGRLKSLVRLFVDYHVKLPKEISNMHALEELTSFSALMYSPDFLKELGQLTNMR VLRVICDCDSFKGDAGSCLENLASSLCNLGTYNLHSLFVDINGYGEDNFSLDTWQPVP SRLRRFSIDRWCPINKIPNWVGSLINLEELVLYVNKIWQEDFELLGHMPALSSLTIYS NTALQGRIIISGFHSTKFFKFYCNPAGLTFDAGSLLKLECLDVIMNVFNTKSSNGSFD FGIQYLTNLRNVYIQLDCNGSTGGELEAAKASIKSSVNKLPGQPKLNLSTLNENMLVH EEAN</aaseq>

Gene Sequence

<dnaseqindica>40..827#3433..5401#acaacatgtgctgtgaatttgaaaggggaaataccagctatggaagcagcgatagtgagtgcttcgacgggagtgatgcgttccctcctcgccaagctcacaaaccttcttggtggtgagtacaagctacttaagtggctccgtagggagatggagttcctcgagagcgagctccgtagcatgagcatcttcttggagaggttggaggacacgcaaaagcttcacccccaaatgaaggattggagggatcgagtacgcgagttggcatacgacattgaggattgcatcgacgacttcatactacagcttgattccaaggatgcgaaggttgggtttgggcaaaagcttcttgcatcccgtaggattggccacatgattcgagaactcaaggcgcgtgtaatggaggagagtgagagacaaaggaggtacatgcttgatggcttggcatctgggcctagtgttcgtgtgaaggttgatccacggctatcggctctctatgtcgacgaggacagattagttggtattgatgccccgagagatgagatcattgggcggctgttggacaagcggagaagtgcctcagcaaaacaggtcatgacaatttccatcgtgggttgcggaggattggggaagaccacccttgccaatcaaatttactgcaaaatcaaaggaaaatttgagtgcgcagcttttgcgtcagtgttccaaaatcccaacaccaagaaggttttgacgaatattctttcccaagtggccactactgctgctgtggaagacgatgagcaagccatcatcaacaagctaagggaataccttagtgacaagaggtacgtacaccaccatccctatgtttttttttatgacgttttaatatggattaggatctaatactccctctatttttactttggccaagtttacagagaaattttagcaacatctataacaacaaatttgttttattaaaactaacatacaatatatttgataatatgtttgttttgtgttgaacatgttactatattttttataaacctagtcaaacataaaaaaaaattaactaacaaaagagtcaaaacgattaatgatatgaaacatatgtagtaattgatattcctagtataccatgtagggtactacactcaagggtaatatagacttttcgctaatcctatacacctcacatgctacaaatgctgatctaatatggtacttctccacactccttgtaagtggcacaggtgctccgtagcaattgagacctgccaataatccttccatttatccttatatgcgtgaacccgccatgggcattcatctttctccttcacacacacctcacctcataaacatttttgcatgacttctctaccctcaactccctttgaatcttccaatggaaaaagtacgaattacacccccccccccgaactatcgcggttgaccgaattaccccctacccgattgagatgacttaatctctatcgggcattaactaaagaccatcacagatgactcatccgtgacggactctatactaatgcccgattgagatgacttaatctttatcgggcattaactaaagcccatcactgatgattatttttccattttccatatgaaatgtttatattcaatttatgtggtattttttattttcaatttatgagaactttaaatataattttaggctgatttttgtgtttcaaatgtaaaaaacacaaacaacaaaattgtacaactcatcgagatttacaactattgtattggtcctttttacaaataagtacatttgaacaatttaaattttgaatgttcaaaatttgacatcttcgaacaaaaatagggttaataaatgatatcaaatagaaaagtcaccaaaaccaaaattgtagaattcatcgaggtgcaaaatttttattttggtcatttttccatctgactctatttgaacaatttgaaatttgaaattcaaagtttgagaactttaaatagaattctttttattagtgaacgacttcaactgaaaagtcattaacaacaacaaagctgtataactcatcaaggtctataacttttattttggtcatttttctatataacgttttttaacaatttgaatttgaatttgaaaatatgacaacttcaaataacatttttaaatactaaatgatttcaactagaaaagtcatcaacaacaaagttgtataacacatcaagatctataacttttatttcggtcatttctttattcgacaaagtgatagtaacattattcacaaaattcacatatctctcatctagctattttatgaacaatgttactaacactttgtcagatgaaaaaatgacaaaaataaaagttatagatcttgataagttatacaactttgttgttgatgacttttttagttgaaattatttagtatttgaaaatgttgttttgaagttatcatattttcaaattcaaattcaaactattcaaaaaaagttatatagaaaaatggccaaactaaaagttgtaaatcttgataagttatacaattttgttgttgacaattttttcatttggaatcatttagtatttgaaaatgttatttgaagttgtcatatttttaaattcaaattcaaactgttaaaaaaagttatatagaaaaatgaccaaactaaaagttgtaaatcttgataagttatacaattttgttgttgacaatttttccatttgaaatcatttactacccgaaaaattattttgactaataaaataaattattatactgcagttaattattttgctacaggtcaacttacaatataaacatttcatataaaaaatagaaaaatactcatcggtgatgggcattagttaaaccctgatagagattaagtcatatcaatcgagcattagtatagagcccgtcatatcaatcgggcctagtttgtatctaaatcgggcccaagttggtgcccgtcacggatgacagccaacttgaggcccgattgagatatggaatgttatctcaatcaggcctaaactacggcctgtcacgaatagattttattcgtgacgggcctgagttttatacccatctaacatgtctgtgcgaccatatctcaatcggacgctttatcggcccgattgagataacttccttgtgacagcccgctaattccaggcatgttagaggcagccacagatggaaggatctgtacttgtgtcagataagcataaaaatttcgtctagctccattgctcatgctccctttttactttttttttagtttttttgtcactcattttaatataagaattaatagttatttgagatttattttcctatttacatgtaataattaaggtagtacatggttattcctcagaaaactgtaactccgtgcgtgcataactcaaacatgtgatgtgttacacaggtacattgtcatagttgatgatatatgggatatgcaaatatggaaatttattgaatgtgcgttggtcaagaactgccgtggtagcagaattatcacaacaacacgtatacatgatattgctaaattgtgctgttcatctcatggcgattatatttacgaaatgaagcctcttggagttattgactccaaaatattgttcgacaaaagaatttttgatccagaggaaaggcgcccaccgcagttgacagaagtttctgaggaaatattgaaaaaatgtggtggtttgcctttggcgatcatttccatatcaagtttgttggcaagcaaaccaaagtcaaaagatcaatgggacagggtcaaggtttctcttagctctacgcttgaaaggactccagacattgaaaccatggaatgggtgctatcactcagttactctgatcttcctaatcatttaaaaacatgtctgttatatttgagtatattccctgagggctatgagataaacagggaacgtttggtgagtagatggattgctgaaggattcatttacaaaaaacatggacaaaatccatatgaagtgggggacagttattttaatgagcttgtgaacagaagcttgattcaaccagcaaacattaagcctgatggtcagacaaatgcttgtcgagtggatgacaccgttcatgattttattgtgtccatgtcagttgaagaaaatttcgttacattatttggtggttcaaaattggtaccaaggtcacatggtaaggttcgtcgattatctattcaaaatggcggcattcaagaaaatattgtcacatcaacgcacttggttacatcgcaagtccggtcactaactttatttgctgtagaaatgccatctcttttaggttttggtatgttacgtgtattggacctagaagattgttatgcattagaagaccatcatcttacgaacctggaaaggctagtccagttacggtatttgagtataagaacatcacccattagtgaactcccgaaacaaattgggcagcttcaatatctggaaacactagatttaagagctacgggtgtggaagaattgccatcaaccattggtagactaaagagtttggtccgtttattcgttgattatcatgttaaattaccaaaagaaatcagcaatatgcatgcactggaagagctaacaagtttctcagccttgatgtactctccagactttctgaaagaactaggtcagcttacaaacatgagggtgctccgagtaatttgtgactgtgatagctttaaaggtgatgcaggaagttgcttggaaaatttagcttcttctttatgtaatctaggcacatataaccttcattccctttttgttgacatcaatggatatggtgaagacaacttctcactagatacatggcaacctgttccatctagactaagaagattttccattgaccggtggtgccccatcaataagattccgaattgggtgggttcactgatcaaccttgaagagttagtcctatatgtcaacaaaatttggcaggaggatttcgaattgctaggacatatgcctgctctgtcatctctgaccatatactcaaatactgcccttcaagggaggatcatcatcagtggattccattctaccaagtttttcaagttctattgcaatcctgcagggttaacctttgacgcaggaagtctgttaaagctcgaatgccttgatgtcataatgaatgtgttcaacacgaagtcttcaaatggtagctttgattttggcattcaatatcttaccaaccttagaaatgtctacattcaacttgattgtaatgggtcgactggtggagaattggaagcagctaaagcttccatcaagagctcagtaaacaaacttccaggacagcctaagctgaacttgagcacattgaatgaaaatatgttagtccatgaagaagctaattaattaaatggaaggggacgtaaatttcgagtacgaacattgcaggtatcaatttcggttttgattttttttttttgcagaaaggaccagtaccaaaaataccatttgtaatttatagtctaacaattctttacccatcaaaataattctcc</dnaseqindica>

External Link(s)

NCBI Gene:Os11g0249000, RefSeq:Os11g0249000