Difference between revisions of "Os11g0225300"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Evolution)
Line 17: Line 17:
 
===Evolution===
 
===Evolution===
 
Phylogenetic Analysis:To identify homologous protein sequences in the Nipponbare rice reference genome, BLASTp searches (Altschul et al., 1997) against the OrygenesDB database were performed  (Droc et al., 2006). The protein alignment generated with ClustalX (Larkin et al., 2007) was manually edited and curated, and gaps were removed for further analyses. We used MEGA 5.05 (Tamura et al., 2011) to reconstruct maximum parsimony, maximum likelihood, and distance trees. For the maximum parsimony analysis, we used the heuristic search algorithm to explore the possible topologies. For the maximum likelihood analysis, we used the JTT + G amino acid substitution model. Accordingto the smallest Akaike information criterion (AIC), this model was determined
 
Phylogenetic Analysis:To identify homologous protein sequences in the Nipponbare rice reference genome, BLASTp searches (Altschul et al., 1997) against the OrygenesDB database were performed  (Droc et al., 2006). The protein alignment generated with ClustalX (Larkin et al., 2007) was manually edited and curated, and gaps were removed for further analyses. We used MEGA 5.05 (Tamura et al., 2011) to reconstruct maximum parsimony, maximum likelihood, and distance trees. For the maximum parsimony analysis, we used the heuristic search algorithm to explore the possible topologies. For the maximum likelihood analysis, we used the JTT + G amino acid substitution model. Accordingto the smallest Akaike information criterion (AIC), this model was determined
to be the best-fit model using ProtTest 3 (Darriba et al., 2011),which estimates the likelihood and the parameter values of 112 different protein evolution models using a maximum likelihood framework. For the distance analysis, we used neighbor joining with the JTT + G amino acid substitution model. For the three analyses, we performed 1000 bootstrap replicates to assess the support for the nodes and displayed the bootstrap consensus tree.
+
to be the best-fit model using ProtTest 3 (Darriba et al., 2011),which estimates the likelihood and the parameter values of 112 different protein evolution models using a maximum likelihood framework. For the distance analysis, we used neighbor joining with the JTT + G amino acid substitution model. For the three analyses, we performed 1000 bootstrap replicates to assess the support for the nodes and displayed the bootstrap consensus tree.<ref name="ref7" />
 
Interestingly, RGA4 and RGA5 also confer resistance againstM. oryzae isolates expressing the avirulence gene AVR-Pia,which shows no sequence similarity to AVR1-CO39 (Yoshidaet al., 2009; Okuyama et al., 2011). Therefore, RGA4 and RGA5 together constitute the genetically defined Pia and Pi-CO39resistance genes. Accordingly, perfect association between Pia and Pi-CO39 resistance was observed when a collection of rice cultivars was analyzed for resistance to M. oryzae strains carrying
 
Interestingly, RGA4 and RGA5 also confer resistance againstM. oryzae isolates expressing the avirulence gene AVR-Pia,which shows no sequence similarity to AVR1-CO39 (Yoshidaet al., 2009; Okuyama et al., 2011). Therefore, RGA4 and RGA5 together constitute the genetically defined Pia and Pi-CO39resistance genes. Accordingly, perfect association between Pia and Pi-CO39 resistance was observed when a collection of rice cultivars was analyzed for resistance to M. oryzae strains carrying
either AVR-Pia or AVR1-CO39. Hence, our study demonstrates that the pair of CC-NB-LRR proteins RGA4 and RGA5 possesses a dual Avr recognition specificity. Such dual specificity for a pair of NB-LRR proteins had previously been demonstrated for RPS4 and RRS1, a TIR-NB-LRR pair that is required to recognize the P. syringae effector AvrRps4, the Ralstonia solanacearum effector PopP2, and a still uncharacterized factor produced by Colletotrichum higginsianum (Gassmann et al.,1999; Deslandes et al., 2002; Birker et al., 2009; Narusaka et al.,2009). The present work provides therefore an example of dualrecognition mediated by a pair of distinct CC-NB-LRR proteins.
+
either AVR-Pia or AVR1-CO39. Hence, our study demonstrates that the pair of CC-NB-LRR proteins RGA4 and RGA5 possesses a dual Avr recognition specificity. Such dual specificity for a pair of NB-LRR proteins had previously been demonstrated for RPS4 and RRS1, a TIR-NB-LRR pair that is required to recognize the P. syringae effector AvrRps4, the Ralstonia solanacearum effector PopP2, and a still uncharacterized factor produced by Colletotrichum higginsianum (Gassmann et al.,1999; Deslandes et al., 2002; Birker et al., 2009; Narusaka et al.,2009). The present work provides therefore an example of dualrecognition mediated by a pair of distinct CC-NB-LRR proteins.<ref name="ref8" />
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 04:52, 3 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Plant resistance to microbial pathogens is a complex process relying on two major levels of resistance controlled by distinct types of plant receptors (Jones and Dangl, 2006; Dodds and Rathjen, 2010). The first line of plant defense is activated by plasma membrane proteins called pattern recognition receptors,which perceive conserved microbial molecules called pathogenassociated molecular patterns (PAMPs). Adapted plant pathogens are able to bypass this PAMP-triggered immunity by producing secreted effectors that act inside or outside the host cell and manipulate key components of plant defense (Jones and Dangl, 2006). The second layer of plant immunity relies on the specific recognition of certain pathogen-derived effectors called Avirulence (Avr) proteins by so-called plant resistance (R) proteins. This effector-triggered immunity (ETI) gives rise to stronger and faster defense responses than PAMP-triggered immunity and often involves a form of localized programmed cell death called the hypersensitive response (HR) (Dodds and Rathjen, 2010). The largest class of R proteins belongs to the conserved family of NB-LRR proteins (Tameling and Takken,2007). They contain a central nucleotide binding (NB) domain,also known as the NB-ARC (for NB adaptor shared by Apaf-1,certain R proteins, and CED-4) domain, and a C-terminal leucinerich repeat (LRR) domain. In monocot R proteins, the LRR repeatmotif is often not conserved (Bai et al., 2002) and in those cases,the domain is called leucine-rich domain (Monosi et al., 2004;Zhou et al., 2004). NB-LRR proteins are further subdivided according to their N-terminal domain into two major subclasses(Meyers et al., 1999; Pan et al., 2000). Proteins of the TIR-NB-LRR class possess an N-terminal Toll Interleukin-1 (TIR) domain,whereas CC-NB-LRR class proteins harbor a structured coiledcoil(CC) domain. Both N-terminal domains seem to be involved in R protein homodimerization and in the activation of defensesignaling (Bernoux et al., 2011; Maekawa et al., 2011). In the absence of the Avr protein, R proteins are maintained in an inactive conformation to avoid inappropriate defense activationand cell death (Takken and Goverse, 2012).[1] [2]

Expression

Seven Avr genes from M. oryzae have been cloned. Except ACE1 and AVR-Pita, which encode an enzyme involved in the synthesis of a secondary metabolite (Böhnert et al., 2004) and a putative metalloprotease (Orbach et al., 2000), respectively,Avr genes from the rice blast fungus encode small secreted proteins of unknown function. Experimental evidence indicates that recognition of AVR-Pita, AVR-Pia, and AVR-Pik/km/kp occurs inside host cells by their corresponding cytoplasmic R proteins (Jia et al., 2000; Yoshida et al., 2009; Kanzaki et al.,2012). Recently, we characterized molecularly the AVR1-CO39gene and demonstrated that it encodes a small secreted protein,expressed specifically during infection (Ribot et al., 2013). AVR1-CO39 is translocated inside the cytoplasm of rice cells where it is recognized by the product of the so far uncharacterized Pi-CO39R gene (Ribot et al., 2013).[3] The molecular mechanism of M. oryzae Avr protein recognition has only been investigated in the case of AVR-Pita and AVR-Pik (Jia et al., 2000; Kanzaki et al., 2012). AVR-Pita is recognized through direct binding to the Pi-ta C-terminal LRD domain, whereas AVR-Pik specifically associates with an N-terminal domain of Pik-1, including the CC domain and additional unclassified sequences upstream of the NB domain.Hence, those examples illustrate two cases of direct recognitionthat seem to implicate different R protein domains and different mechanisms.[4] Transient Protein Expression in N. benthamiana For Agrobacterium-mediated N. benthamiana leaf transformations,transformed GV3101 pMP90 strains were grown in Luria-Bertani liquid medium containing 50 mg mL21 rifampicin, 15 mg mL21 gentamycin, and 25 mg mL21 kanamycin at 28°C for 24 h before use. Bacteria were.[5] harvested by centrifugation, resuspended in infiltration medium (10 mM MES, pH 5.6, 10 mM MgCl2, and 150 mM acetosyringone) to an OD600 of1, and incubated for 2 h at room temperature before leaf infiltration. The infiltrated plants were incubated for 36 or 48 h in growth chambers under controlled conditions for FRET-FLIM or coimmunoprecipitation experiments,respectively.[6]

Evolution

Phylogenetic Analysis:To identify homologous protein sequences in the Nipponbare rice reference genome, BLASTp searches (Altschul et al., 1997) against the OrygenesDB database were performed (Droc et al., 2006). The protein alignment generated with ClustalX (Larkin et al., 2007) was manually edited and curated, and gaps were removed for further analyses. We used MEGA 5.05 (Tamura et al., 2011) to reconstruct maximum parsimony, maximum likelihood, and distance trees. For the maximum parsimony analysis, we used the heuristic search algorithm to explore the possible topologies. For the maximum likelihood analysis, we used the JTT + G amino acid substitution model. Accordingto the smallest Akaike information criterion (AIC), this model was determined to be the best-fit model using ProtTest 3 (Darriba et al., 2011),which estimates the likelihood and the parameter values of 112 different protein evolution models using a maximum likelihood framework. For the distance analysis, we used neighbor joining with the JTT + G amino acid substitution model. For the three analyses, we performed 1000 bootstrap replicates to assess the support for the nodes and displayed the bootstrap consensus tree.[7] Interestingly, RGA4 and RGA5 also confer resistance againstM. oryzae isolates expressing the avirulence gene AVR-Pia,which shows no sequence similarity to AVR1-CO39 (Yoshidaet al., 2009; Okuyama et al., 2011). Therefore, RGA4 and RGA5 together constitute the genetically defined Pia and Pi-CO39resistance genes. Accordingly, perfect association between Pia and Pi-CO39 resistance was observed when a collection of rice cultivars was analyzed for resistance to M. oryzae strains carrying either AVR-Pia or AVR1-CO39. Hence, our study demonstrates that the pair of CC-NB-LRR proteins RGA4 and RGA5 possesses a dual Avr recognition specificity. Such dual specificity for a pair of NB-LRR proteins had previously been demonstrated for RPS4 and RRS1, a TIR-NB-LRR pair that is required to recognize the P. syringae effector AvrRps4, the Ralstonia solanacearum effector PopP2, and a still uncharacterized factor produced by Colletotrichum higginsianum (Gassmann et al.,1999; Deslandes et al., 2002; Birker et al., 2009; Narusaka et al.,2009). The present work provides therefore an example of dualrecognition mediated by a pair of distinct CC-NB-LRR proteins.[8]

Labs working on this gene

  • INRA, UMR 385 Biologie et Génétique des Interactions Plante-Parasite, F-34398 Montpellier, France
  • CIRAD, UMR Biologie et Génétique des Interactions Plante-Parasite, F-34398 Montpellier, France
  • CNRS, Plateforme Imagerie-Microscopie, Fédération de Recherche FR3450, 31326 Castanet-Tolosan, France
  • INRA, UMR 441 Laboratoire des Interactions Plantes-Microorganismes, F-31326 Castanet-Tolosan, France
  • CNRS, UMR 2594 Laboratoire des Interactions Plantes-Microorganismes, F-31326 Castanet-Tolosan, France
  • Iwate Biotechnology Research Center, Kitakami, Iwate 024-0003, Japan

References

  1. Stella Cesari;Gaëtan Thilliez;Cécile Ribot, et al. (2013) The Rice Resistance Protein Pair RGA4/RGA5 Recognizes the Magnaporthe oryzae Effectors AVR-Pia and AVR1-CO39 by Direct Binding.The Plant Cell, 25(4): 1463-1481.
  2. Altschul, S.F., Madden, T.L., Schäffer, A.A., Zhang, J., Zhang, Z.,Miller, W., and Lipman, D.J. (1997). Gapped BLAST and PSIBLAST:A new generation of protein database search programs.Nucleic Acids Res. 25: 3389–3402.
  3. Ashikawa, I., Hayashi, N., Yamane, H., Kanamori, H., Wu, J.,Matsumoto, T., Ono, K., and Yano, M. (2008). Two adjacent nucleotide-binding site-leucine-rich repeat class genes are required toconfer Pikm-specific rice blast resistance. Genetics 180: 2267–2276.
  4. Bai, J., Pennill, L.A., Ning, J., Lee, S.W., Ramalingam, J., Webb,C.A., Zhao, B., Sun, Q., Nelson, J.C., Leach, J.E., and Hulbert,S.H. (2002). Diversity in nucleotide binding site-leucine-rich repeatgenes in cereals. Genome Res. 12: 1871–1884.
  5. Ballini, E., Morel, J.B., Droc, G., Price, A., Courtois, B., Notteghem,J.L., and Tharreau, D. (2008). A genome-wide meta-analysis of rice blast resistance genes and quantitative trait loci provides newinsights into partial and complete resistance. Mol. Plant Microbe Interact. 21: 859–868.
  6. Bernoux,M., Ve, T., Williams, S.,Warren, C., Hatters, D., Valkov, E.,Zhang, X., Ellis, J.G., Kobe, B., and Dodds, P.N. (2011). Structural and functional analysis of a plant resistance protein TIR domainreveals interfaces for self-association, signaling, and autoregulation.Cell Host Microbe 9: 200–211.
  7. Berruyer, R., Adreit, H., Milazzo, J., Gaillard, S., Berger, A., Dioh,W., Lebrun, M.-H., and Tharreau, D. (2003). Identification and finemapping of Pi33, the rice resistance gene corresponding to theMagnaporthe grisea avirulence gene ACE1. Theor. Appl. Genet.107: 1139–1147.
  8. Birker, D., Heidrich, K., Takahara, H., Narusaka, M., Deslandes, L.,Narusaka, Y., Reymond, M., Parker, J.E., and O’Connell, R.J.(2009). A locus conferring resistance to Colletotrichum higginsianum isshared by four geographically distinct Arabidopsis accessions. Plant J.60: 602–613.

Structured Information

Gene Name

Os11g0225300

Description

Disease resistance protein family protein

Version

NM_001074069.1 GI:115484786 GeneID:4350112

Length

7166 bp

Definition

Oryza sativa Japonica Group Os11g0225300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 11

Location

Chromosome 11:6537450..6544615

Sequence Coding Region

6537456..6538285,6539404..6541536,6543349..6544291

Expression

GEO Profiles:Os11g0225300

Genome Context

<gbrowseImage1> name=NC_008404:6537450..6544615 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008404:6537450..6544615 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggatgctccggtgagtttctccctaggtgccatgggccctctcctcaggaagctcgattcgcttccggtggctcccgaaatccggctgcctgagccactgaaggacggaatcgagctcctcaaggaagatctagaagaaatcggtgccgccctcgtggagcagtccatggtagattccccaagccacagggcaagatactggatggatgaggtgcgtgacctctcctaccacatcgaggactgcatcgacaccatgttttcgatgcgctgcggcggcgacgacggcaagcccagatccgttcgccgccacaaggttggccgtgtgaaggttgacggtttctccaagacgcagaagccgtgcacgaggctcgccaggatcgcggagctcagggctctggtgcgggaggccagcgagcgccacgaaaggtaccagcttggtgacggccgcgcctcgagctcgagctcgagctctcaccgcgtgttcactgcgcacggccaggttcctgcgccgtgcagaaatctggttggcatggacgaaccgaagacgaagctcaccaatatgctcaccgacgaagcagagctgcatatgaaagtggtatgcattcttggatcagccggtattggtaagaccacgcttgctgaacaagtataccgtaaacttagatggcaattcgattgccatgcttttgtgcgggcatcacgaaaacctgacatgaggaggcttcttggggccatcctctctcaagttcagctgcgtatacggatatctgataccagcacggtgcagagccttattgataatctctgggagtatctacagaaaaagaggtattttattgtaattgatgaattatatgaaacagcaacatgggatatcattaccagtgcttttccagaggataataattgcagtaggataatgactacggctggaattgaaggtgtagctctcgaatgctgcagttatcattctgtcaatattttcaagatgatacctcttggccttgatgattctgcaaaattattctttaatagagtttttggatcagagcaacaatgtccttatgaattgaatgaagtttcatataggattacagcaaaatgtggtggattgccactagcagtcattattatagccggtcttttagcaagcctgccgtgcaaaacagagctgtggtacaatatagatggatgtttatgttccagtgtgactacagatattgatttggatgagatactgaaggaaatcataagtcttggctacgacaatcttccacattatttgaagacatgtctgttgtatcttagtttatattcggagggtttcataatttggacggctgacttactgaagcaatggatatctgaaggtttcatcgctgtaatagatggagaagacatagaggaagtcgctgagagctatttctataaccttgttaacaggggaatgatccaaagtgtgaaaactaagtacaataatcaggtgttgtgtactgtgcaccacactgtatttgatcttattattcacaagtccaaagaagagaaatttatctccgcaatagattactctcaaactatgccaggaaattctttagaggctcgtcgattgtcattccactttagcaataccagatatgcaactgaagttgcaggtattacactgtcacaagttcgttcgtttgcctttcttggacttctgaagtgtatgccttctattatggaatttaagcttcttcgggttctaattcttgaattttggggagataaccatggatgcatgagttttaacgttgcaagaatttgtagattgtttcagcttagatatttgaagatctcaagccaaataataatagaattaccagcccagatccgggggctaaaatacttggaaacacttgaaatagatgcaagagtaactgcgattccatctgatattattcatctccgaagtttgttgcatctatattttcaagatgggatcgttctacctgatggcattggctgcatcagatctttgcgtacacttaagtattttgatcttggaagtaactctgaagagaatatacggagtcttggtcagctgacgaacttacgggatcttcatctcacttgttctgcaccaaaatctaatcagcaggcaaagagaaacctcgtaattctagcctcttatactgggaaactcggtaacctcaaatctgtcaaattttctcctggtgattcaggcatggatatttcctttttgttttatggaattggtatttcggttgatcgttccagaacagcgtcctctcttcctttctctgttaggacattagagttgccatccatttgcatatttgctagacttcctgactggattggtcaactccgtaaactccacacattgaatcttgctgttagagaactgatagaaaatgatattgatagtcttgcaggactgcctgacctcattgttctctcaatgcatatcatgaaagctcctatggaaaggattgtcttcaacagaaaagcatttccagttctcaagtatttcaagtttatatgtggcacactgcgcatggcttttcaggcaggagccatggccaatcttcacaggctcaagctaggtttcaatgcccataaaggggagaagtatgacaatattcttgtaggcattgagcacctattaaacctcaagaagattgctgttcgaattggaggagctgctgaagccaaggagtctgacaggatggctgcagaggctgcgttgaaagaagccattagaaagcatctaatgtttcttgatgatctcgacatagcaagggtagaatgtgttaaggaagagtataagtgtattaagaaaaaacacaagatcaagattgaagattcaattagcgaaaaaaatggggactcaaaaaagcagcattctgtcgaaaagaaagcagtgtggggcaaaactatgaagaatattgctgatagtggcgtgtttcctgaagattatactatgtcaagggagcaacgggtcgcagaaggcttcgtagtgggcattgaaaagtgcagggcagaggatgcggccgagcgaataatcaggaatgtgcctgtggactatgatgggcttggccaggtgagcacatccaagatacaggaccacttgcctgaacttgctcctcgtgctgtgcaaaacgagaagttcggctcttcaaatgatcttagcataatgatacaaatcaacaagtatgctcgtctgccatcttatgagtggagggacactgatatatccaaactgaatttccggcttctccgcgccccgatgttacttgaagctgtaacggcccgttgtcacttgttggacttaatcctcattggttcaaacaacattactgttcttgaccttggacgtcccacaatcaccaaactgccggcatctatagaatgtctacctaatttacggtacttgaggttgcagggcacgcaactgaagtcgctgtcggaggttattgtgaagatgcccaccatcagggggttggacatcaagaataccaagacagaggagctaccacaaggcattttgaggatgaagaagttgagtcacctgagtatgggggagaagcagaaaaatattcaagtattcatggaaaaaatgcagactctggctgagaccgtccaagacagcgatgacttgtccgacgaaacagagggaatagccgacgacgaaggcgagttctctacaagggccaacgcgtcaacaccgaaggtggatgaggacgaggtggaccggagggccaataacttcatcgccaggttcaggaagcagatcacgatcaggaattcaggattcgccaaaaaggagagcagcatcgacgaacgactgtggatacgagatctcgatgagtgccaactctccaagagaggtggacgattttaa</cdnaseq>

Protein Sequence

<aaseq>MDAPVSFSLGAMGPLLRKLDSLPVAPEIRLPEPLKDGIELLKED LEEIGAALVEQSMVDSPSHRARYWMDEVRDLSYHIEDCIDTMFSMRCGGDDGKPRSVR RHKVGRVKVDGFSKTQKPCTRLARIAELRALVREASERHERYQLGDGRASSSSSSSHR VFTAHGQVPAPCRNLVGMDEPKTKLTNMLTDEAELHMKVVCILGSAGIGKTTLAEQVY RKLRWQFDCHAFVRASRKPDMRRLLGAILSQVQLRIRISDTSTVQSLIDNLWEYLQKK RYFIVIDELYETATWDIITSAFPEDNNCSRIMTTAGIEGVALECCSYHSVNIFKMIPL GLDDSAKLFFNRVFGSEQQCPYELNEVSYRITAKCGGLPLAVIIIAGLLASLPCKTEL WYNIDGCLCSSVTTDIDLDEILKEIISLGYDNLPHYLKTCLLYLSLYSEGFIIWTADL LKQWISEGFIAVIDGEDIEEVAESYFYNLVNRGMIQSVKTKYNNQVLCTVHHTVFDLI IHKSKEEKFISAIDYSQTMPGNSLEARRLSFHFSNTRYATEVAGITLSQVRSFAFLGL LKCMPSIMEFKLLRVLILEFWGDNHGCMSFNVARICRLFQLRYLKISSQIIIELPAQI RGLKYLETLEIDARVTAIPSDIIHLRSLLHLYFQDGIVLPDGIGCIRSLRTLKYFDLG SNSEENIRSLGQLTNLRDLHLTCSAPKSNQQAKRNLVILASYTGKLGNLKSVKFSPGD SGMDISFLFYGIGISVDRSRTASSLPFSVRTLELPSICIFARLPDWIGQLRKLHTLNL AVRELIENDIDSLAGLPDLIVLSMHIMKAPMERIVFNRKAFPVLKYFKFICGTLRMAF QAGAMANLHRLKLGFNAHKGEKYDNILVGIEHLLNLKKIAVRIGGAAEAKESDRMAAE AALKEAIRKHLMFLDDLDIARVECVKEEYKCIKKKHKIKIEDSISEKNGDSKKQHSVE KKAVWGKTMKNIADSGVFPEDYTMSREQRVAEGFVVGIEKCRAEDAAERIIRNVPVDY DGLGQVSTSKIQDHLPELAPRAVQNEKFGSSNDLSIMIQINKYARLPSYEWRDTDISK LNFRLLRAPMLLEAVTARCHLLDLILIGSNNITVLDLGRPTITKLPASIECLPNLRYL RLQGTQLKSLSEVIVKMPTIRGLDIKNTKTEELPQGILRMKKLSHLSMGEKQKNIQVF MEKMQTLAETVQDSDDLSDETEGIADDEGEFSTRANASTPKVDEDEVDRRANNFIARF RKQITIRNSGFAKKESSIDERLWIRDLDECQLSKRGGRF</aaseq>

Gene Sequence

<dnaseqindica>7..836#1955..4087#5900..6842#ggcggcatggatgctccggtgagtttctccctaggtgccatgggccctctcctcaggaagctcgattcgcttccggtggctcccgaaatccggctgcctgagccactgaaggacggaatcgagctcctcaaggaagatctagaagaaatcggtgccgccctcgtggagcagtccatggtagattccccaagccacagggcaagatactggatggatgaggtgcgtgacctctcctaccacatcgaggactgcatcgacaccatgttttcgatgcgctgcggcggcgacgacggcaagcccagatccgttcgccgccacaaggttggccgtgtgaaggttgacggtttctccaagacgcagaagccgtgcacgaggctcgccaggatcgcggagctcagggctctggtgcgggaggccagcgagcgccacgaaaggtaccagcttggtgacggccgcgcctcgagctcgagctcgagctctcaccgcgtgttcactgcgcacggccaggttcctgcgccgtgcagaaatctggttggcatggacgaaccgaagacgaagctcaccaatatgctcaccgacgaagcagagctgcatatgaaagtggtatgcattcttggatcagccggtattggtaagaccacgcttgctgaacaagtataccgtaaacttagatggcaattcgattgccatgcttttgtgcgggcatcacgaaaacctgacatgaggaggcttcttggggccatcctctctcaagttcagctgcgtatacggatatctgataccagcacggtgcagagccttattgataatctctgggagtatctacagaaaaagaggtaattaattaacgctatattcactgctttttaatactagttcagctactgagcatcaccaatagactctcaaaattctattcccaaaaatctgttattgggcgttctaaactgattttggggtgttgaatgtattcctccttccaacaaattggcttaattaactgcctaaaattaaggacttggcccatgtaaaaactattaacagaaatcatgctccccatcatccatcatccagcgtgatcacatctgcatgatcggccacgcctccctccgcgatcactcccgccatgattttgggagtcaaccctctcccctagaagagtagagcaagacatacgggaatgggagctgcaaaattttggtagacctttcggatattgttggagcaagatttttacaaaaaaaattgtaaattttggtattgggaatgattttgggagactcttgtgaggctatctccaacccttcatgtcattagcatgaggggactcagtgtccatagcattaagtatattgtcacatcggaaaaaatctgaggtggcaagagagttaatgaggagagagatgaaaagatgaagaaaccatctcttcacaacaaccaagaatgaaaacaagtgataggttcataaaaggagagagaagaaagatgattggatatatagtgtctatatgacatagcaagtatggaaactactttgatagtttctaggttggggatggcctgatgctgcacattgaacaattgctgttccctccgtcacattgaataaggcgcgcatgcattttaaaattgaactctctaaatatctgatcaataatattttgttataaattaacttttatttgacaaaaataatatcattggattgacatttaaatttactttgatataattgtgattttgttgttacaaatatcatagtattttagatattcaaaatcaaagatttgttttaaaaaccataccaagtttgactgcgccggataaagggggtaatttagaaaataaataaataaataaatatattatcctgataaacttcctttcctttttgagagagacctgatacactttgttcttttcccagagaatataatttaattatactttgcaggtattttattgtaattgatgaattatatgaaacagcaacatgggatatcattaccagtgcttttccagaggataataattgcagtaggataatgactacggctggaattgaaggtgtagctctcgaatgctgcagttatcattctgtcaatattttcaagatgatacctcttggccttgatgattctgcaaaattattctttaatagagtttttggatcagagcaacaatgtccttatgaattgaatgaagtttcatataggattacagcaaaatgtggtggattgccactagcagtcattattatagccggtcttttagcaagcctgccgtgcaaaacagagctgtggtacaatatagatggatgtttatgttccagtgtgactacagatattgatttggatgagatactgaaggaaatcataagtcttggctacgacaatcttccacattatttgaagacatgtctgttgtatcttagtttatattcggagggtttcataatttggacggctgacttactgaagcaatggatatctgaaggtttcatcgctgtaatagatggagaagacatagaggaagtcgctgagagctatttctataaccttgttaacaggggaatgatccaaagtgtgaaaactaagtacaataatcaggtgttgtgtactgtgcaccacactgtatttgatcttattattcacaagtccaaagaagagaaatttatctccgcaatagattactctcaaactatgccaggaaattctttagaggctcgtcgattgtcattccactttagcaataccagatatgcaactgaagttgcaggtattacactgtcacaagttcgttcgtttgcctttcttggacttctgaagtgtatgccttctattatggaatttaagcttcttcgggttctaattcttgaattttggggagataaccatggatgcatgagttttaacgttgcaagaatttgtagattgtttcagcttagatatttgaagatctcaagccaaataataatagaattaccagcccagatccgggggctaaaatacttggaaacacttgaaatagatgcaagagtaactgcgattccatctgatattattcatctccgaagtttgttgcatctatattttcaagatgggatcgttctacctgatggcattggctgcatcagatctttgcgtacacttaagtattttgatcttggaagtaactctgaagagaatatacggagtcttggtcagctgacgaacttacgggatcttcatctcacttgttctgcaccaaaatctaatcagcaggcaaagagaaacctcgtaattctagcctcttatactgggaaactcggtaacctcaaatctgtcaaattttctcctggtgattcaggcatggatatttcctttttgttttatggaattggtatttcggttgatcgttccagaacagcgtcctctcttcctttctctgttaggacattagagttgccatccatttgcatatttgctagacttcctgactggattggtcaactccgtaaactccacacattgaatcttgctgttagagaactgatagaaaatgatattgatagtcttgcaggactgcctgacctcattgttctctcaatgcatatcatgaaagctcctatggaaaggattgtcttcaacagaaaagcatttccagttctcaagtatttcaagtttatatgtggcacactgcgcatggcttttcaggcaggagccatggccaatcttcacaggctcaagctaggtttcaatgcccataaaggggagaagtatgacaatattcttgtaggcattgagcacctattaaacctcaagaagattgctgttcgaattggaggagctgctgaagccaaggagtctgacaggatggctgcagaggctgcgttgaaagaagccattagaaagcatctaatgtttcttgatgatctcgacatagcaagggtagaatgtgttaaggaagagtataagtgtattaagaaaaaacacaagatcaagattgaagattcaattagcgaaaaaaatggggactcaaaaaagcagcattctgtcgaaaagaaagcagtgtggggcaaaactatgaagaatattgctgatagtgggtatgttctttcctattatttcagcctctacattttccaatatatattgtttagaaataaatgattactacaacaataaccttatagtaaaacgctaaaacacagttgtatcaaaaggaatctttacaaaggtacatctatgctctttgaaaaggataagatgggatgctctatactaattggagcctctactagaagctttcacattaaccttagaaggcaaaagactggaaattcccacattaacaaaaaagaaaactaaaagcattaatctttgaaagatcaaatggtatgcgccaatgtatcaaatctaaggttgatatcttccaccacagaatatgtgcatttatcaaatttggaatcaataaatacctagttatacttggtttggacactcgagtatagtattttgatgaataataattgaaacattcagcattaacaaatattgagttttactcggtctagagtctcactagcttattttttatgattttattttataattccgaaattcagaattgataaatactgtgttgtactaggtttgaagtttttgttgaataatagtttcaaaattcaaaaacaataaatatgctcaatttagagcgtagagtaattttctcatgacctaataattctgcagtttagatttaatcatagtatctcatgatttgataattcaaaaatcgaaattaatacatactcagttgatgcttgtacattcacacgggttaatttctaccggtgtccaagcggtgtagcaagatcaaatagtatgggttagactcaatttacactttgtagtcaaagttgtgtgaccttgtaagcaatctagacaaatggcaaatctatggctatctaaaatttaaaacaaatcagacatgctatttacgggaagctgttttgatccctcaagagaatgtccctcgcttgtaaaaaaaaaccatctagaattctcaaaaaaaattcacaacattcatactatgtatgtatgtatgtatgcatgcatgcatgcatgcacacacacacacatgtatgtacatataacacatatacatatacatatacatattcatacataacgcacacacacaaattaacttaaatttttgaaaattttcaacttatgagtatatactaaggtacaagaatttgattcgtacctatatctagcaacaaaacaactcaaattcaactttattttacaatccattattacatacctaactaattatatgtttgggtggtatatacctagaagcaaaatctaacaaaaaaatgttcaaatttagttcaaacttgttagtaaagaagttaatgtccatacctgatctacattgccttgctctcatcatcgtcagcgttgtggcctttctcacaggcaacctctcctcgctcgagatccataaaaacaagagagaaaaaaatggattggttagttcgtgtgtgtatctatatataggtctatagtaaaaaaattactgggtgatgcgttgtgggatgggcgatgctggtagtctgcgggggtgggtttacacacacaacactccactaggtccaaactcaatttataacatttaggtataaaaaataaatatattcataccggaatttgtctttttgtttctcaatatataggtcgaatttgaagttgttctctcgtggaatgttagatgtcactgtactccacattgttaattaaatttttataactattttaattgaatttaaaagcaaaaaagtatatgaggggatatcctttcgtgggattagaattcattcctgctattaactagacctgtattgcagcgtgtttcctgaagattatactatgtcaagggagcaacgggtcgcagaaggcttcgtagtgggcattgaaaagtgcagggcagaggatgcggccgagcgaataatcaggaatgtgcctgtggactatgatgggcttggccaggtgagcacatccaagatacaggaccacttgcctgaacttgctcctcgtgctgtgcaaaacgagaagttcggctcttcaaatgatcttagcataatgatacaaatcaacaagtatgctcgtctgccatcttatgagtggagggacactgatatatccaaactgaatttccggcttctccgcgccccgatgttacttgaagctgtaacggcccgttgtcacttgttggacttaatcctcattggttcaaacaacattactgttcttgaccttggacgtcccacaatcaccaaactgccggcatctatagaatgtctacctaatttacggtacttgaggttgcagggcacgcaactgaagtcgctgtcggaggttattgtgaagatgcccaccatcagggggttggacatcaagaataccaagacagaggagctaccacaaggcattttgaggatgaagaagttgagtcacctgagtatgggggagaagcagaaaaatattcaagtattcatggaaaaaatgcagactctggctgagaccgtccaagacagcgatgacttgtccgacgaaacagagggaatagccgacgacgaaggcgagttctctacaagggccaacgcgtcaacaccgaaggtggatgaggacgaggtggaccggagggccaataacttcatcgccaggttcaggaagcagatcacgatcaggaattcaggattcgccaaaaaggagagcagcatcgacgaacgactgtggatacgagatctcgatgagtgccaactctccaagagaggtggacgattttaagaagaagttcgacgagatcattgccaggaacaggcacacatggaagccaatcgagtcaccgcgttctgtcaagcacggcaagtatttcgttcgctgcccgccgtcgctaatcaccagcgctgtcttttcctttttctttctttctatttttctagtatggtactccctccgtttcaggatattgtcaggaaacccctaatcaatcgccttgtgaacactggatgaactcacgcgaaagtggaagaacacgtagaacacaatagtgtagacgaacagacaacaaaaacagagtttttggtgctgcctgaattgcttgcagctttt</dnaseqindica>

External Link(s)

NCBI Gene:Os11g0225300, RefSeq:Os11g0225300