Difference between revisions of "Os01g0869900"

From RiceWiki
Jump to: navigation, search
(→‎Function)
(→‎Function)
Line 4: Line 4:
 
===Function===
 
===Function===
 
Please input function information here.
 
Please input function information here.
−
　SNF1 regulate many cellular responses to environmental and nutritional stresses<ref name="ref1" />.
+
* SNF1 regulate many cellular responses to environmental and nutritional stresses<ref name="ref1" />.
−
　　Key metabolic enzymes in plants, such as HMG-CoA reductase and sucrose phosphate synthase are regulated by SnRK phosphorylation:Sucrose synthase is the key enzyme in carbon metabolism which is controlled by SnRK1 protein kinases.SnRK1 can directly phosphorylate HMG-CoA reductase and sucrose phosphate synthase resulting in loss of activity<ref name="ref2" />.
+
* Key metabolic enzymes in plants, such as HMG-CoA reductase and sucrose phosphate synthase are regulated by SnRK phosphorylation:Sucrose synthase is the key enzyme in carbon metabolism which is controlled by SnRK1 protein kinases.SnRK1 can directly phosphorylate HMG-CoA reductase and sucrose phosphate synthase resulting in loss of activity<ref name="ref2" />.
−
　　SnRK1 kinase plays an important role in carbon-nitrogen interactions.SnRK1 can regulate the activity of those important physiological effects of substrate, which gives us a new way of thinking about the co-regulation of sugar, nitrogen compounds and the variety of secondary metabolites<ref name="ref3" /><ref name="ref4" />.
+
* SnRK1 kinase plays an important role in carbon-nitrogen interactions.SnRK1 can regulate the activity of those important physiological effects of substrate, which gives us a new way of thinking about the co-regulation of sugar, nitrogen compounds and the variety of secondary metabolites<ref name="ref3" /><ref name="ref4" />.
−
　　SnRKs also play a role in controlling the expression of sucrose synthase genes. Antisense expression of SnRK1 made SnRK1 activity decrease, coupling with the decrease of sucrose synthase activity<ref name="ref5" />.SnRK1 could also regulate the expression of other genes, which can encode carbohydrate metabolism enzymes.
+
* SnRKs also play a role in controlling the expression of sucrose synthase genes. Antisense expression of SnRK1 made SnRK1 activity decrease, coupling with the decrease of sucrose synthase activity<ref name="ref5" />.
−
　　It has been proposed that SnRKs regulate global carbon assimilation.and may also have a wider role in hormonal and stress signalling.such as in abscisic acid (ABA) and hyperosmotic stress signaling<ref name="ref6" />.
+
* SnRK1 could also regulate the expression of other genes, which can encode carbohydrate metabolism enzymes.It has been proposed that SnRKs regulate global carbon assimilation.and may also have a wider role in hormonal and stress signalling.such as in abscisic acid (ABA) and hyperosmotic stress signaling<ref name="ref6" />.
−
　　Antisense gene expressions in different plant indicate that SnRK1 has very important roles in plant growth and development processes<ref name="ref7" />.
+
* Antisense gene expressions in different plant indicate that SnRK1 has very important roles in plant growth and development processes<ref name="ref7" />.
  
 
===Expression===
 
===Expression===

Revision as of 11:12, 3 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

  • SNF1 regulate many cellular responses to environmental and nutritional stresses[1].
  • Key metabolic enzymes in plants, such as HMG-CoA reductase and sucrose phosphate synthase are regulated by SnRK phosphorylation:Sucrose synthase is the key enzyme in carbon metabolism which is controlled by SnRK1 protein kinases.SnRK1 can directly phosphorylate HMG-CoA reductase and sucrose phosphate synthase resulting in loss of activity[2].
  • SnRK1 kinase plays an important role in carbon-nitrogen interactions.SnRK1 can regulate the activity of those important physiological effects of substrate, which gives us a new way of thinking about the co-regulation of sugar, nitrogen compounds and the variety of secondary metabolites[3][4].
  • SnRKs also play a role in controlling the expression of sucrose synthase genes. Antisense expression of SnRK1 made SnRK1 activity decrease, coupling with the decrease of sucrose synthase activity[5].
  • SnRK1 could also regulate the expression of other genes, which can encode carbohydrate metabolism enzymes.It has been proposed that SnRKs regulate global carbon assimilation.and may also have a wider role in hormonal and stress signalling.such as in abscisic acid (ABA) and hyperosmotic stress signaling[6].
  • Antisense gene expressions in different plant indicate that SnRK1 has very important roles in plant growth and development processes[7].

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0869900

Description

Serine/threonine-protein kinase SAPK4 (EC 2.7.1.37) (Osmotic stress/abscisic acid-activated protein kinase 4)

Version

NM_001051465.1 GI:115441300 GeneID:4324934

Length

4594 bp

Definition

Oryza sativa Japonica Group Os01g0869900, complete gene.

Source

Oryza sativa Japonica Group 

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:39466088..39470681

Sequence Coding Region

39466284..39466403,39466558..39466632,39467186..39467287,39467380..39467433,39467618..39467710
,39467803..39467895,39469738..39469842,39469944..39470042,39470146..39470487

Expression

GEO Profiles:Os01g0869900

Genome Context

<gbrowseImage1> name=NC_008394:39466088..39470681 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:39466088..39470681 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagaagtacgaggcggtgagggacatcgggtcggggaacttcggggtggcgcggctgatgcgcaaccgcgagacccgcgagctcgtcgccgtcaagtgcatcgagcgcggccaccggatagatgagaatgtgtacagggagatcatcaaccaccgctcgctgcgccaccccaacatcattcgcttcaaggaggtgatactgacgccaacgcatcttatgattgtcatggagttcgcagcaggcggggagctgttcgatcgaatctgtgatcgtggacggttcagtgaggatgaggccaggtatttctttcagcagctgatctgtggagtgagctactgccatcacatgcaaatatgccatagagatttgaagttggagaatgttctcttggatggcagcccagctccacggcttaagatatgtgattttggctactccaagtcatcagtattgcattcaagacccaaatcagcagtggggacgccagcatatatcgcaccagaggtgctatcccgccgtgagtatgatggaaagcttgcagatgtatggtcctgtggtgtgactctttacgtcatgcttgtgggagcctacccatttgaagaccaggacgaccccaagaacattcgcaaaaccattcagagaataatgtcagtgcaatataagataccagattacgtccacatatctgcagaatgcaaacagcttattgcccgcatttttgtcaacaatccattgaggagaatcacgatgaaggaaataaagagccacccgtggttcttgaagaacctccccagggagctcacggagactgcgcaagccatgtactacaggagggacaactccgtgccttccttctcagaccagacctcagaagagatcatgaagattgttcaagaagcaagaaccatgccgaaatcatccaggacaggctactggagcgacgcgggttcagacgaggaggagaaggaagaggaagagaggccagaagagaacgaggaagaggaggaagatgagtacgataagagggtcaaagaggtccatgcgagcggggagctccgtatgagctcactgcgcatatga</cdnaseq>

Protein Sequence

<aaseq>MEKYEAVRDIGSGNFGVARLMRNRETRELVAVKCIERGHRIDEN VYREIINHRSLRHPNIIRFKEVILTPTHLMIVMEFAAGGELFDRICDRGRFSEDEARY FFQQLICGVSYCHHMQICHRDLKLENVLLDGSPAPRLKICDFGYSKSSVLHSRPKSAV GTPAYIAPEVLSRREYDGKLADVWSCGVTLYVMLVGAYPFEDQDDPKNIRKTIQRIMS VQYKIPDYVHISAECKQLIARIFVNNPLRRITMKEIKSHPWFLKNLPRELTETAQAMY YRRDNSVPSFSDQTSEEIMKIVQEARTMPKSSRTGYWSDAGSDEEEKEEEERPEENEE EEEDEYDKRVKEVHASGELRMSSLRI</aaseq>

Gene Sequence

<dnaseqindica>197..316#471..545#1099..1200#1293..1346#1531..1623#1716..1808#3651..3755#3857..3955#4059..4400#cgagaggcgccgcgccaccatcaccacccaccccgctcctcgcgccgccgacgcgccacccgccggcgacggcgaggaccgcgccgccggtgtcatcgtgccgtgccgatccctcccccggcggatccacgggctgagccgatcccgtccgtggagaggagaggaggaggggagggggaaggggagagggggggagatggagaagtacgaggcggtgagggacatcgggtcggggaacttcggggtggcgcggctgatgcgcaaccgcgagacccgcgagctcgtcgccgtcaagtgcatcgagcgcggccaccgggttggttttttttgttcgttcgttccccctttgattttacttttttttggggggttctttttaaggattgaggtgggttgatcggtgggtggaggattgattgctgggttggattatgacgggttttttttcttctgggatctgtgcgtggcagatagatgagaatgtgtacagggagatcatcaaccaccgctcgctgcgccaccccaacatcattcgcttcaaggaggttcgttcgtgccacggatttgcttttatcccattttgaacgttttttcccctgttttatatcaaaagttgcttgatcctaattacagagtggctccaaatgatgcagataaggatgcacttttttttaattctgagaaccgttaaattttagtttgagagttgctgatttctctaaacttcatgcagtgacggaatcttctgaattgatgttaaacagctgcatttttgttccttccttccttttccccctttcatttctttcgttatagtctatcttacccttgcgtctctgtaccatctacacacgtatgaatgattctagtggcatggttgcatgtgctttgggttagacacagatttatctgtgtctttttttttcttttgcacaatttgaaacataaacgccaggacatctttcttttttccaatgtaggagtaaattgtgaagggacgaaggaatcgtgttgtcctgttggctttacctgttccttctttcagaaaagaggggcactctgttattaattgttttttttttgggaaaaatcctgcaggtgatactgacgccaacgcatcttatgattgtcatggagttcgcagcaggcggggagctgttcgatcgaatctgtgatcgtggacggttcagtgaggatgaggtcccgtgatttattcctgagttttactactttataaccctgtcttatgttgaacgagcaatattaatattcttttattctgcttgatgcaggccaggtatttctttcagcagctgatctgtggagtgagctactgccatcacatggtatgcaacaaacagttaactcattcaagaggaccaattcaccatctctaagcaataattactactgtaccctgtttcagttttatcattcagagtgttggtagttttcatttgattttataactgagctaaatctttatgagtttctaattatattattctggtgtcaatcttccaactacagcaaatatgccatagagatttgaagttggagaatgttctcttggatggcagcccagctccacggcttaagatatgtgattttggctactccaaggtttgttgccaaacccactgtcattttagcaatcttggagctattggaatctctgtagattctcagaataatgtctttccgttcttgatcagtcatcagtattgcattcaagacccaaatcagcagtggggacgccagcatatatcgcaccagaggtgctatcccgccgtgagtatgatggaaaggtgagttattttgaccccttgttggtttctgacatgcatttcattttgtttcttttgaatgattatttgttgatggaaaggtgaaaagaacccctagtaggtagtgaaatagagcgtttatttgtttggtgtctgaaacagaactccttatctggacatgttatgtgcaaataatgcaagttgaactaaaaagtgttttttggtcaaactgtgagagtagcgaggcataatattatcggttctccaagcttttttaggtgaataaagtagccaatgcctctattatagtttaacttctccatcaaatccacataatagatgcacctcttccaatgattgtgacattccatatattcagctcctaaatggctaaattcgttagaaatcgggttgaatgatccttcacaaaatgaatgggttccttcatacaatttacatgatcactgagagtatcttaataaatatcctacttgttagttactcattaacttggttaatgttcactagctaatcaaaccatactatttattattgttttttattttttgattattagtggttagtctgcagatctagtactagtatatatgcaaaacctcttttgcaactgttggtggacagccttgtttggtctaattaggtggaattcacagctattctttgatagtgcatttcataattagctacagtcacaaatattggaccagtagaggatctgaaatcgagtgatgcttctgatttggatgagtagtcattgtctgcatgaggtgctcaaacatcttctgtttggtttgttgaggcttaatgtaccacaaaggatgtagaacctttgattcaatagttccacatgttattgcctccttaattggtccacaggaatatatagagaatgtttcactgtgcttcatgataaagccaaaaatgacattttgattcaacacacatgttcaattcagtaagttttcacttgaaatattaccccttgaatatttgggtaacttcaactttttttttatccctgggaagtgggaacccatgtgctaaaacaccagttttcaaggtcaaactcgagatcattttgtacatttgctgagtttttaaaaggtgaaatagaaacattaccctgaaactgacctacaattttttttcttcttctttttattcttctttttttttctttttttttggggtggtgacttctcaattttgaagcaactaagttttcttagttttacttgaacaaggtcaaccaaaatgcatcattttgtataactaaactgtcctttttatattattgtacctgactaactgcttggctgactattgggtttcatgcatgtcatcctacactggatgtgctccacatgttctttagtattatcgcactgacatcgattataaatagtctaaaccacccatcagaacttattggctgctctcaattcattactatactgtatatcattcttactacaatacaaggaacctgtgtatcattctaaacttcaatgcgacagcagaacagaactgcaacaaataaaggtgatctggtcaaacaagcatactcctaagtccactgaacactggtgttggcacctcactaccctgaagcctagcaaccttgtgataaaaccttttaacataaatggcattaagcccaaactgtgctttactgtcacaacatgacctattcatcactgagttctgataaaatcctagtagttctgaaccttttcacttattttctcctgaagcatttcacttcattctactgaatgttagtagaattacgatcagagagtatggtcctactcattggcaacaatgggcttgttgatgtagcttgcagatgtatggtcctgtggtgtgactctttacgtcatgcttgtgggagcctacccatttgaagaccaggacgaccccaagaacattcgcaaaaccattcaggtgacaagctgaacccttaagtcattcatatccatccaatttctgcaggttttctttttgtgactcgcttcctcattccagtcgctgttgttcatccacagagaataatgtcagtgcaatataagataccagattacgtccacatatctgcagaatgcaaacagcttattgcccgcatttttgtcaacaatccattgagggtaatataactcaaattttatttccattttattttgaggaaaccatggtgtatctgtccttaacctaacatgttattaacacaataatttgaatgttgtccagagaatcacgatgaaggaaataaagagccacccgtggttcttgaagaacctccccagggagctcacggagactgcgcaagccatgtactacaggagggacaactccgtgccttccttctcagaccagacctcagaagagatcatgaagattgttcaagaagcaagaaccatgccgaaatcatccaggacaggctactggagcgacgcgggttcagacgaggaggagaaggaagaggaagagaggccagaagagaacgaggaagaggaggaagatgagtacgataagagggtcaaagaggtccatgcgagcggggagctccgtatgagctcactgcgcatatgaaaaagtttgtgtgcagctattgtgtagataatccggcttactatggaactgcggtgtatgcaattttcgctgtaaatttgcttctgtttggcgtttcttcgtgtaacataacttacttgggggcgcttggacttcaattgtctgattatgttttgtaagtacctacatattaagcgtatgctatgtacttggtg</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0869900, RefSeq:Os01g0869900

  1. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref4
  5. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref5
  6. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref6
  7. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref7
Retrieved from "https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0869900&oldid=176672"