Difference between revisions of "Os01g0869900"

From RiceWiki
Jump to: navigation, search
(Expression)
(Evolution)
Line 20: Line 20:
 
===Evolution===
 
===Evolution===
 
Please input evolution information here.
 
Please input evolution information here.
 
+
  SnRK2 protein kinase family has evolved specifically for hyperosmotic stress signaling and that individual members have acquired distinct regulatory properties, including ABA responsiveness by modifying the C-terminal domain<ref name="ref8" />.
 +
  SnRK have a very important role in plant stress resistance,Under nutritional deficiency, the growth conditions of transgenic plant were better than the control group in Arabidopsis<ref name="ref9" />.
 +
  A novel protein phosphatase designated AtPTPKIS1 containing a protein tyrosine phosphatase (PTP) catalytic domain and a kinase interaction sequence (KIS) domain interact with plant SNF1-related kinases as regulators of metabolic and stress responses<ref name="ref10" />.
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  

Revision as of 11:15, 3 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

  • SNF1 regulate many cellular responses to environmental and nutritional stresses[1].
  • Key metabolic enzymes in plants, such as HMG-CoA reductase and sucrose phosphate synthase are regulated by SnRK phosphorylation:Sucrose synthase is the key enzyme in carbon metabolism which is controlled by SnRK1 protein kinases.SnRK1 can directly phosphorylate HMG-CoA reductase and sucrose phosphate synthase resulting in loss of activity[2].
  • SnRK1 kinase plays an important role in carbon-nitrogen interactions.SnRK1 can regulate the activity of those important physiological effects of substrate, which gives us a new way of thinking about the co-regulation of sugar, nitrogen compounds and the variety of secondary metabolites[3][4].
  • SnRKs also play a role in controlling the expression of sucrose synthase genes. Antisense expression of SnRK1 made SnRK1 activity decrease, coupling with the decrease of sucrose synthase activity[5].
  • SnRK1 could also regulate the expression of other genes, which can encode carbohydrate metabolism enzymes.It has been proposed that SnRKs regulate global carbon assimilation.and may also have a wider role in hormonal and stress signalling.such as in abscisic acid (ABA) and hyperosmotic stress signaling[6].
  • Antisense gene expressions in different plant indicate that SnRK1 has very important roles in plant growth and development processes[7].

Expression

Please input expression information here.

  • The SnRK is a class of Ser/Thr protein kinase, which widely exists in plant and involves in a variety of signaling pathways.In plants, SnRKs were grouped into three subfamilies: SnRK1, SnRK2, and SnRK3[2].
  • SnRK1 subfamily: The SnRK1 was discovered initially in the rye.According to the similarity of amino acid sequences, SnRK1 is divided into SnRK1a and SnRK1b. SnRK1a expressed throughout the developmental period of the plant. But expression of SnRK1b in seeds is very high quality, and other parts of the plant are relatively low.
  • SnRK2 subfamily: SnRK2 sub-family is unique in plantsAccording to the similarity of amino acid sequence, SnRK2 is divided into SnRK2a and SnRK2b.SnRK2 protein contains a relatively short C-terminal, characterized of the C-terminal acidic with a short "patch."
  • SnRK3 subfamily: SnRK3 is a rare protein kinase in plant,called calcineurin B-like calcium sensor-interacting protein kinases.

Evolution

Please input evolution information here.   SnRK2 protein kinase family has evolved specifically for hyperosmotic stress signaling and that individual members have acquired distinct regulatory properties, including ABA responsiveness by modifying the C-terminal domain[8].   SnRK have a very important role in plant stress resistance,Under nutritional deficiency, the growth conditions of transgenic plant were better than the control group in Arabidopsis[9].   A novel protein phosphatase designated AtPTPKIS1 containing a protein tyrosine phosphatase (PTP) catalytic domain and a kinase interaction sequence (KIS) domain interact with plant SNF1-related kinases as regulators of metabolic and stress responses[10]. You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0869900

Description

Serine/threonine-protein kinase SAPK4 (EC 2.7.1.37) (Osmotic stress/abscisic acid-activated protein kinase 4)

Version

NM_001051465.1 GI:115441300 GeneID:4324934

Length

4594 bp

Definition

Oryza sativa Japonica Group Os01g0869900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:39466088..39470681

Sequence Coding Region

39466284..39466403,39466558..39466632,39467186..39467287,39467380..39467433,39467618..39467710
,39467803..39467895,39469738..39469842,39469944..39470042,39470146..39470487

Expression

GEO Profiles:Os01g0869900

Genome Context

<gbrowseImage1> name=NC_008394:39466088..39470681 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:39466088..39470681 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagaagtacgaggcggtgagggacatcgggtcggggaacttcggggtggcgcggctgatgcgcaaccgcgagacccgcgagctcgtcgccgtcaagtgcatcgagcgcggccaccggatagatgagaatgtgtacagggagatcatcaaccaccgctcgctgcgccaccccaacatcattcgcttcaaggaggtgatactgacgccaacgcatcttatgattgtcatggagttcgcagcaggcggggagctgttcgatcgaatctgtgatcgtggacggttcagtgaggatgaggccaggtatttctttcagcagctgatctgtggagtgagctactgccatcacatgcaaatatgccatagagatttgaagttggagaatgttctcttggatggcagcccagctccacggcttaagatatgtgattttggctactccaagtcatcagtattgcattcaagacccaaatcagcagtggggacgccagcatatatcgcaccagaggtgctatcccgccgtgagtatgatggaaagcttgcagatgtatggtcctgtggtgtgactctttacgtcatgcttgtgggagcctacccatttgaagaccaggacgaccccaagaacattcgcaaaaccattcagagaataatgtcagtgcaatataagataccagattacgtccacatatctgcagaatgcaaacagcttattgcccgcatttttgtcaacaatccattgaggagaatcacgatgaaggaaataaagagccacccgtggttcttgaagaacctccccagggagctcacggagactgcgcaagccatgtactacaggagggacaactccgtgccttccttctcagaccagacctcagaagagatcatgaagattgttcaagaagcaagaaccatgccgaaatcatccaggacaggctactggagcgacgcgggttcagacgaggaggagaaggaagaggaagagaggccagaagagaacgaggaagaggaggaagatgagtacgataagagggtcaaagaggtccatgcgagcggggagctccgtatgagctcactgcgcatatga</cdnaseq>

Protein Sequence

<aaseq>MEKYEAVRDIGSGNFGVARLMRNRETRELVAVKCIERGHRIDEN VYREIINHRSLRHPNIIRFKEVILTPTHLMIVMEFAAGGELFDRICDRGRFSEDEARY FFQQLICGVSYCHHMQICHRDLKLENVLLDGSPAPRLKICDFGYSKSSVLHSRPKSAV GTPAYIAPEVLSRREYDGKLADVWSCGVTLYVMLVGAYPFEDQDDPKNIRKTIQRIMS VQYKIPDYVHISAECKQLIARIFVNNPLRRITMKEIKSHPWFLKNLPRELTETAQAMY YRRDNSVPSFSDQTSEEIMKIVQEARTMPKSSRTGYWSDAGSDEEEKEEEERPEENEE EEEDEYDKRVKEVHASGELRMSSLRI</aaseq>

Gene Sequence

<dnaseqindica>197..316#471..545#1099..1200#1293..1346#1531..1623#1716..1808#3651..3755#3857..3955#4059..4400#cgagaggcgccgcgccaccatcaccacccaccccgctcctcgcgccgccgacgcgccacccgccggcgacggcgaggaccgcgccgccggtgtcatcgtgccgtgccgatccctcccccggcggatccacgggctgagccgatcccgtccgtggagaggagaggaggaggggagggggaaggggagagggggggagatggagaagtacgaggcggtgagggacatcgggtcggggaacttcggggtggcgcggctgatgcgcaaccgcgagacccgcgagctcgtcgccgtcaagtgcatcgagcgcggccaccgggttggttttttttgttcgttcgttccccctttgattttacttttttttggggggttctttttaaggattgaggtgggttgatcggtgggtggaggattgattgctgggttggattatgacgggttttttttcttctgggatctgtgcgtggcagatagatgagaatgtgtacagggagatcatcaaccaccgctcgctgcgccaccccaacatcattcgcttcaaggaggttcgttcgtgccacggatttgcttttatcccattttgaacgttttttcccctgttttatatcaaaagttgcttgatcctaattacagagtggctccaaatgatgcagataaggatgcacttttttttaattctgagaaccgttaaattttagtttgagagttgctgatttctctaaacttcatgcagtgacggaatcttctgaattgatgttaaacagctgcatttttgttccttccttccttttccccctttcatttctttcgttatagtctatcttacccttgcgtctctgtaccatctacacacgtatgaatgattctagtggcatggttgcatgtgctttgggttagacacagatttatctgtgtctttttttttcttttgcacaatttgaaacataaacgccaggacatctttcttttttccaatgtaggagtaaattgtgaagggacgaaggaatcgtgttgtcctgttggctttacctgttccttctttcagaaaagaggggcactctgttattaattgttttttttttgggaaaaatcctgcaggtgatactgacgccaacgcatcttatgattgtcatggagttcgcagcaggcggggagctgttcgatcgaatctgtgatcgtggacggttcagtgaggatgaggtcccgtgatttattcctgagttttactactttataaccctgtcttatgttgaacgagcaatattaatattcttttattctgcttgatgcaggccaggtatttctttcagcagctgatctgtggagtgagctactgccatcacatggtatgcaacaaacagttaactcattcaagaggaccaattcaccatctctaagcaataattactactgtaccctgtttcagttttatcattcagagtgttggtagttttcatttgattttataactgagctaaatctttatgagtttctaattatattattctggtgtcaatcttccaactacagcaaatatgccatagagatttgaagttggagaatgttctcttggatggcagcccagctccacggcttaagatatgtgattttggctactccaaggtttgttgccaaacccactgtcattttagcaatcttggagctattggaatctctgtagattctcagaataatgtctttccgttcttgatcagtcatcagtattgcattcaagacccaaatcagcagtggggacgccagcatatatcgcaccagaggtgctatcccgccgtgagtatgatggaaaggtgagttattttgaccccttgttggtttctgacatgcatttcattttgtttcttttgaatgattatttgttgatggaaaggtgaaaagaacccctagtaggtagtgaaatagagcgtttatttgtttggtgtctgaaacagaactccttatctggacatgttatgtgcaaataatgcaagttgaactaaaaagtgttttttggtcaaactgtgagagtagcgaggcataatattatcggttctccaagcttttttaggtgaataaagtagccaatgcctctattatagtttaacttctccatcaaatccacataatagatgcacctcttccaatgattgtgacattccatatattcagctcctaaatggctaaattcgttagaaatcgggttgaatgatccttcacaaaatgaatgggttccttcatacaatttacatgatcactgagagtatcttaataaatatcctacttgttagttactcattaacttggttaatgttcactagctaatcaaaccatactatttattattgttttttattttttgattattagtggttagtctgcagatctagtactagtatatatgcaaaacctcttttgcaactgttggtggacagccttgtttggtctaattaggtggaattcacagctattctttgatagtgcatttcataattagctacagtcacaaatattggaccagtagaggatctgaaatcgagtgatgcttctgatttggatgagtagtcattgtctgcatgaggtgctcaaacatcttctgtttggtttgttgaggcttaatgtaccacaaaggatgtagaacctttgattcaatagttccacatgttattgcctccttaattggtccacaggaatatatagagaatgtttcactgtgcttcatgataaagccaaaaatgacattttgattcaacacacatgttcaattcagtaagttttcacttgaaatattaccccttgaatatttgggtaacttcaactttttttttatccctgggaagtgggaacccatgtgctaaaacaccagttttcaaggtcaaactcgagatcattttgtacatttgctgagtttttaaaaggtgaaatagaaacattaccctgaaactgacctacaattttttttcttcttctttttattcttctttttttttctttttttttggggtggtgacttctcaattttgaagcaactaagttttcttagttttacttgaacaaggtcaaccaaaatgcatcattttgtataactaaactgtcctttttatattattgtacctgactaactgcttggctgactattgggtttcatgcatgtcatcctacactggatgtgctccacatgttctttagtattatcgcactgacatcgattataaatagtctaaaccacccatcagaacttattggctgctctcaattcattactatactgtatatcattcttactacaatacaaggaacctgtgtatcattctaaacttcaatgcgacagcagaacagaactgcaacaaataaaggtgatctggtcaaacaagcatactcctaagtccactgaacactggtgttggcacctcactaccctgaagcctagcaaccttgtgataaaaccttttaacataaatggcattaagcccaaactgtgctttactgtcacaacatgacctattcatcactgagttctgataaaatcctagtagttctgaaccttttcacttattttctcctgaagcatttcacttcattctactgaatgttagtagaattacgatcagagagtatggtcctactcattggcaacaatgggcttgttgatgtagcttgcagatgtatggtcctgtggtgtgactctttacgtcatgcttgtgggagcctacccatttgaagaccaggacgaccccaagaacattcgcaaaaccattcaggtgacaagctgaacccttaagtcattcatatccatccaatttctgcaggttttctttttgtgactcgcttcctcattccagtcgctgttgttcatccacagagaataatgtcagtgcaatataagataccagattacgtccacatatctgcagaatgcaaacagcttattgcccgcatttttgtcaacaatccattgagggtaatataactcaaattttatttccattttattttgaggaaaccatggtgtatctgtccttaacctaacatgttattaacacaataatttgaatgttgtccagagaatcacgatgaaggaaataaagagccacccgtggttcttgaagaacctccccagggagctcacggagactgcgcaagccatgtactacaggagggacaactccgtgccttccttctcagaccagacctcagaagagatcatgaagattgttcaagaagcaagaaccatgccgaaatcatccaggacaggctactggagcgacgcgggttcagacgaggaggagaaggaagaggaagagaggccagaagagaacgaggaagaggaggaagatgagtacgataagagggtcaaagaggtccatgcgagcggggagctccgtatgagctcactgcgcatatgaaaaagtttgtgtgcagctattgtgtagataatccggcttactatggaactgcggtgtatgcaattttcgctgtaaatttgcttctgtttggcgtttcttcgtgtaacataacttacttgggggcgcttggacttcaattgtctgattatgttttgtaagtacctacatattaagcgtatgctatgtacttggtg</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0869900, RefSeq:Os01g0869900

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. 2.0 2.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. Cite error: Invalid <ref> tag; no text was provided for refs named ref4
  5. Cite error: Invalid <ref> tag; no text was provided for refs named ref5
  6. Cite error: Invalid <ref> tag; no text was provided for refs named ref6
  7. Cite error: Invalid <ref> tag; no text was provided for refs named ref7
  8. Cite error: Invalid <ref> tag; no text was provided for refs named ref8
  9. Cite error: Invalid <ref> tag; no text was provided for refs named ref9
  10. Cite error: Invalid <ref> tag; no text was provided for refs named ref10