Difference between revisions of "Os06g0660200"

From RiceWiki
Jump to: navigation, search
(Function)
(Annotated Information)
Line 2: Line 2:
  
 
==Annotated Information==
 
==Annotated Information==
[[链接文字]]===Function===
+
===Function===
OsPIN2was proposed as an auxin efflux transporter and a member of the PIN family (Wanget al., 2009). The cDNA
+
OsPIN2was proposed as an auxin efflux transporter and a member of the PIN family [[Media:(Wanget al., 2009).]] The cDNA
 
sequence of OsPIN2(AK101191) comprises 2276 nucleotides and alignment between the cDNA, and the genomic sequence
 
sequence of OsPIN2(AK101191) comprises 2276 nucleotides and alignment between the cDNA, and the genomic sequence
 
revealed that the gene has seven exons and six introns (Figure S1A). The ORF encodes a protein of 629 amino acid
 
revealed that the gene has seven exons and six introns (Figure S1A). The ORF encodes a protein of 629 amino acid

Revision as of 12:11, 3 June 2014

Please input one-sentence summary here.

Annotated Information

Function

OsPIN2was proposed as an auxin efflux transporter and a member of the PIN family Media:(Wanget al., 2009). The cDNA sequence of OsPIN2(AK101191) comprises 2276 nucleotides and alignment between the cDNA, and the genomic sequence revealed that the gene has seven exons and six introns (Figure S1A). The ORF encodes a protein of 629 amino acid residues and shows 56.3% sequence identity with Arabidopsis AtPIN2 .Hydropathy and transmembrane (TM) motif analyses of the amino acid sequence revealed that the OsPIN2 protein contains three characteristic regions, including a hydrophobic region with five TM domains, a predominantly hydrophilic core, followed by another hydrophobic region with four TM segments .

The gain of function ofOsPIN2in rice plants

It was previously reported that knockdown of OsPIN1bexpression very significantly increased the number of tillers and tiller angle, while over-expression did not alter the shoot architecture of rice (Xuet al., 2005). In the rice genome, OsLazy1 has been identified as a novel grass-specific protein playing a negative role in polar auxin transport; its mutation resulted in an increase in the rice tiller angle (Abe et al., 1996; Li et al., 2007; Yoshihara and Iino, 2007). It is interesting to speculate whether enhancingOsLazy1expression could compact rice architecture further. In addition, OsTAC1was defined as a tiller angle control gene in rice, its expression level positively correlated with tiller angle and numbers (Yuet al., 2007). Transgenic plants over-expressingOsPIN2showed larger tiller angles, lower plant height, more tillers than WT (Figure 2c–e), which was similar to theOsPIN1bknockdown mutants (Xu et al., 2005). The change of phenotype caused by alteration of OsPIN2andOsPIN1bexpression supported the common observation that rice plant height was negatively correlated with tiller number (Wang and Li, 2005). Therefore, auxin might play a key role in the crosstalk between the plant height and branching, an aspect of canopy architecture which is poorly understood.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

1.Wang, J.R., Hu, H., Wang, G.H., Li, J., Chen, J.Y. and Wu, P. (2009) Expression of PIN Genes in Rice (Oryza sativaL.): tissue specificity and regulation by hormones. Mol. Plant, 2, 823–831

Structured Information

Gene Name

Os06g0660200

Description

Similar to Auxin efflux carrier protein

Version

NM_001064803.1 GI:115469337 GeneID:4341736

Length

3804 bp

Definition

Oryza sativa Japonica Group Os06g0660200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:28077811..28081614

Sequence Coding Region

28077886..28078901,28078996..28079180,28079269..28079572,28080611..28080696,28080796..28080953
,28081075..28081151,28081241..28081307

Expression

GEO Profiles:Os06g0660200

Genome Context

<gbrowseImage1> name=NC_008399:28077811..28081614 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:28077811..28081614 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgatcaccggacgcgacatctacgacgtgctggcggcgatcgtgccgctgtacgtggcgatgttcctggcgtacgggtcggtgcggtggtgggggatattcacgccggaccagtgctccggcatcaaccgcttcgtcgccgtcttcgccgtgccgctcctctccttccacttcatctccaccaacgacccctactccatgaactaccgcttcctcgccgccgactcgctccagaagctcgtcatcctcgccgcgctcgccgtctggcacaacctgctctcccgctaccgccgcaatggcggcgccgccgcgtcgctcgactggaccatcaccctcttctcgctgtccacgctgcccaacacgctggtcatgggcatcccgctgctccgcgccatgtacggcgacttctccggctcgctcatggtgcagatcgtcgtgctccagagcgtcatctggtacaccctcatgctcttcctcttcgagtaccgcggcgccaaggcgctcatctccgagcagttcccgccggacgtcggcgccagcatcgcctcgttccgcgtcgactccgacgtcgtctcgctcaacgggagggaggcgctgcaggcggacgccgaggtggggcgcgacggccgcgtccacgtcgtcatccgccgctccgcctcggcctccaccacgggcggcggcggcggcgcggcgcgctccggcgtgtcccgggcgtacggcgcgtccaacgccatgacgccgcgcgcctccaacctcaccggcgtggagatctactcgctgcagacgtcgcgcgagcccacgccgcgggcgtccagcttcaaccaggccgacttctacgccatgttctccggcagcaagatggccagccagatggctagccccatggcgcagcacggcggcgccggcggccgcgcccagggcctcgacgagcaggtcaccaacaagttcgcctccggcaaggccgccgacccgccgtcgtatcccgccccgaaccccggcatgatgccggcgccaaggaagaaggagctcgggggctcaaactccaactccaacaaggagctacacatgttcgtgtggagctctagcgcgtcgccggtgtcggaggccaacctccgcaacgccgtcaaccacgccgcctccaccgacttcgcctccgcgccgccgccggcagccgttcccgtcggcggcgccactcccaaaggggtgagtggcagtgtcacgccggcggcgaagaacggcggcggcgagttggagatcgaggacgggctgaagagcccggcggcggggctggcggcgaagttcccggtgtcggggtcgccgtacgtggcgccgaggaagaagggcggcggcgccgacgtgcccgggctggcggaggcggcgcacccgatgccgccgacgagcgtgatgacgcggctcatcctcatcatggtgtggcgcaagctcatcagaaaccccaacacctactccagcctcatcggcctcgtctggtccctcgtctccttcaggtggaatatccaaatgccttcaataataaagggctcaatatcaatattgtcagatgcagggctaggaatggctatgttcagcttaggcttgttcatggctctgcaaccaaagatcatttcttgtggcaagaccgttgcgacatttgcaatggcagtgaggttcttgactggtccagctgttattgcagctacttccattgccattgggctcaggggagtactcttgcatgttgccattgttcaggcagcacttccacaaggcattgtcccgtttgtgtttgccaaggagtacaattgccatcctcaaatacttagcacagcggttatttttgggatgctcatcgcgcttccgatcacgatactctactatgtgcttcttgggatatag</cdnaseq>

Protein Sequence

<aaseq>MITGRDIYDVLAAIVPLYVAMFLAYGSVRWWGIFTPDQCSGINR FVAVFAVPLLSFHFISTNDPYSMNYRFLAADSLQKLVILAALAVWHNLLSRYRRNGGA AASLDWTITLFSLSTLPNTLVMGIPLLRAMYGDFSGSLMVQIVVLQSVIWYTLMLFLF EYRGAKALISEQFPPDVGASIASFRVDSDVVSLNGREALQADAEVGRDGRVHVVIRRS ASASTTGGGGGAARSGVSRAYGASNAMTPRASNLTGVEIYSLQTSREPTPRASSFNQA DFYAMFSGSKMASQMASPMAQHGGAGGRAQGLDEQVTNKFASGKAADPPSYPAPNPGM MPAPRKKELGGSNSNSNKELHMFVWSSSASPVSEANLRNAVNHAASTDFASAPPPAAV PVGGATPKGVSGSVTPAAKNGGGELEIEDGLKSPAAGLAAKFPVSGSPYVAPRKKGGG ADVPGLAEAAHPMPPTSVMTRLILIMVWRKLIRNPNTYSSLIGLVWSLVSFRWNIQMP SIIKGSISILSDAGLGMAMFSLGLFMALQPKIISCGKTVATFAMAVRFLTGPAVIAAT SIAIGLRGVLLHVAIVQAALPQGIVPFVFAKEYNCHPQILSTAVIFGMLIALPITILY YVLLGI</aaseq>

Gene Sequence

<dnaseqindica>76..1091#1186..1370#1459..1762#2801..2886#2986..3143#3265..3341#3431..3497#aattagctcgttctcttgtgtcaagaaaaaaaaagaaagaaaaagctcgccgccgccgccaccgtcgccggcgcgatgatcaccggacgcgacatctacgacgtgctggcggcgatcgtgccgctgtacgtggcgatgttcctggcgtacgggtcggtgcggtggtgggggatattcacgccggaccagtgctccggcatcaaccgcttcgtcgccgtcttcgccgtgccgctcctctccttccacttcatctccaccaacgacccctactccatgaactaccgcttcctcgccgccgactcgctccagaagctcgtcatcctcgccgcgctcgccgtctggcacaacctgctctcccgctaccgccgcaatggcggcgccgccgcgtcgctcgactggaccatcaccctcttctcgctgtccacgctgcccaacacgctggtcatgggcatcccgctgctccgcgccatgtacggcgacttctccggctcgctcatggtgcagatcgtcgtgctccagagcgtcatctggtacaccctcatgctcttcctcttcgagtaccgcggcgccaaggcgctcatctccgagcagttcccgccggacgtcggcgccagcatcgcctcgttccgcgtcgactccgacgtcgtctcgctcaacgggagggaggcgctgcaggcggacgccgaggtggggcgcgacggccgcgtccacgtcgtcatccgccgctccgcctcggcctccaccacgggcggcggcggcggcgcggcgcgctccggcgtgtcccgggcgtacggcgcgtccaacgccatgacgccgcgcgcctccaacctcaccggcgtggagatctactcgctgcagacgtcgcgcgagcccacgccgcgggcgtccagcttcaaccaggccgacttctacgccatgttctccggcagcaagatggccagccagatggctagccccatggcgcagcacggcggcgccggcggccgcgcccagggcctcgacgagcaggtcaccaacaagttcgcctccggcaaggccgccgacccgccgtcgtatcccgccccgaaccccggcatgatgccggcgccaaggtaaaatgaaactgattattaacacctcaaaatttctgttcatcgatcgtgttttgatcgagttggatttttgattttgtcgccattgctacaggaagaaggagctcgggggctcaaactccaactccaacaaggagctacacatgttcgtgtggagctctagcgcgtcgccggtgtcggaggccaacctccgcaacgccgtcaaccacgccgcctccaccgacttcgcctccgcgccgccgccggcagccgttcccgtcggcggcgccactcccaaaggtactctctcatccatccattgacgcacacgacgacgatcacaccacatgtgttcaaggcttcgtctaatggtgcgtgcatgccacaggggtgagtggcagtgtcacgccggcggcgaagaacggcggcggcgagttggagatcgaggacgggctgaagagcccggcggcggggctggcggcgaagttcccggtgtcggggtcgccgtacgtggcgccgaggaagaagggcggcggcgccgacgtgcccgggctggcggaggcggcgcacccgatgccgccgacgagcgtgatgacgcggctcatcctcatcatggtgtggcgcaagctcatcagaaaccccaacacctactccagcctcatcggcctcgtctggtccctcgtctccttcaggtattggattctcaccgatgttttcggtactcaagctgacgttctcgcttccacagttccacttcatcgacgcccgctttcccggtcgcttccctctaagatggaacactcttctgccaatacattttgacatcccacagctatgacagatcgcttatcccggttcatcttcagggcaagggcgctttttttcaagttataccgaattatcaaaacagattatttactctccatttcaaaaaagtattttataaaaaaaaatattcttctactacattacttagattacttgttttaagctagttgttaagtttttttttaaattgtttaatttatttgtataatgaaatcgataatctgcatagtaatctaaaccaaataagtaatatacacttgagttcacgatctgatcaatttatgttgttcgaagctacaaaaaggatatatttttgctatgctattcgttgctagattgcttgaaattttaatctaggaagaggcaagatcgatgagaacttacttaacttcacaactggattagtgttttctgaacgcatgtgagagcacatgataattacgttggtctcggatctggtccagcacatgcaaagaacatacacacgtatgcagatgcaggtgcaggtgcaggtcttatgtgagccctggagtttagcagcagagaccaaatctaccgaatcagctgcgattgccgtgtttgtccccatccaagacagacacggcgaattcggctcaactagctagatgatccatcatgtgtacaagaagaagagcaaaaaatgtacaatgatatggatgcatcattgattcattgtactactatcttaccattagatggcacatctagagggagggttgcaagaacagggcatttttagtggggaggagcacatgcctgcaagcatctaaaattgcatacatgcatgatacatctagcattgattctcttgtcatacaatttttttttacattgtgaaaatatatgcttaattgcttattgactttgtgaatttggatcaggtggaatatccaaatgccttcaataataaagggctcaatatcaatattgtcagatgcagggctaggaatggctatgttcagcttaggtacagagttgacctttttgatacatatctatagccataactagtgagttttttctttgctttgaccaagaaattctgacaatagtatatgtaacccaggcttgttcatggctctgcaaccaaagatcatttcttgtggcaagaccgttgcgacatttgcaatggcagtgaggttcttgactggtccagctgttattgcagctacttccattgccattgggctcaggggagtactcttgcatgttgccattgttcaggtaagcagtagattctttatttcttgcaatcatcttaaaagaaaaaaaatattaaattttgtaattatggtgaattggaatgtattgtggtgatcttatagattaattgattgtcaaacaggcagcacttccacaaggcattgtcccgtttgtgtttgccaaggagtacaattgccatcctcaaatacttagcacagcgtaagaaatgcatgcttaaactttctatttgttcgtccatacggttgctgaagtatatagcctaaaatatataaatgtgaaattttcagggttatttttgggatgctcatcgcgcttccgatcacgatactctactatgtgcttcttgggatatagtgttcttgaagaaggcaaaaaagaaagagtagggaaaaaaataggattctaggtttctagaggaaaatgcaaaagaaatatgatatgggctttcttgaagacctgaagaactaccagagctgaagaatagggaaatgagatcaagtaggatcctagctagagagaaatgcaaaggaaagacaccccttgattacaattttttaattttttctgcaactgttttggcatcaaagtaaaggttagggccttgagtatgaagagttcagccgttaatttgacaagttgggttggcggtactaaagattcc</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0660200, RefSeq:Os06g0660200