Difference between revisions of "Os06g0660200"

From RiceWiki
Jump to: navigation, search
(References)
(Expression)
Line 33: Line 33:
  
 
===Expression===
 
===Expression===
'''Generation of transgenic rice showingOsPIN2
+
'''Generation of transgenic rice showingOsPIN2 over-expression and phenotypes of transformants'''
over-expression and phenotypes of transformants'''
 
 
Ubiquitin promoter (pUbi) has been long reported as a useful
 
Ubiquitin promoter (pUbi) has been long reported as a useful
 
strong promoter in a variety of applications in gene transfer
 
strong promoter in a variety of applications in gene transfer

Revision as of 12:51, 3 June 2014

Please input one-sentence summary here.

Annotated Information

Function

OsPIN2was proposed as an auxin efflux transporter and a member of the PIN family (Wanget al., 2009)[1]. The cDNA sequence of OsPIN2(AK101191) comprises 2276 nucleotides and alignment between the cDNA, and the genomic sequence revealed that the gene has seven exons and six introns (Figure S1A). The ORF encodes a protein of 629 amino acid residues and shows 56.3% sequence identity with Arabidopsis AtPIN2 .Hydropathy and transmembrane (TM) motif analyses of the amino acid sequence revealed that the OsPIN2 protein contains three characteristic regions, including a hydrophobic region with five TM domains, a predominantly hydrophilic core, followed by another hydrophobic region with four TM segments .

The gain of function ofOsPIN2in rice plants

It was previously reported that knockdown of OsPIN1bexpression very significantly increased the number of tillers and tiller angle, while over-expression did not alter the shoot architecture of rice (Xuet al., 2005)[2]. In the rice genome, OsLazy1 has been identified as a novel grass-specific protein playing a negative role in polar auxin transport; its mutation resulted in an increase in the rice tiller angle (Abe et al., 1996[3]; Li et al., 2007[4]; Yoshihara and Iino, 2007[5] ). It is interesting to speculate whether enhancingOsLazy1expression could compact rice architecture further. In addition, OsTAC1was defined as a tiller angle control gene in rice, its expression level positively correlated with tiller angle and numbers (Yuet al., 2007))[6]. Transgenic plants over-expressingOsPIN2showed larger tiller angles, lower plant height, more tillers than WT (Figure 2c–e), which was similar to theOsPIN1bknockdown mutants (Xu et al., 2005)[2]. The change of phenotype caused by alteration of OsPIN2andOsPIN1bexpression supported the common observation that rice plant height was negatively correlated with tiller number (Wang and Li, 2005). Therefore, auxin might play a key role in the crosstalk between the plant height and branching, an aspect of canopy architecture which is poorly understood.

Expression

Generation of transgenic rice showingOsPIN2 over-expression and phenotypes of transformants Ubiquitin promoter (pUbi) has been long reported as a useful strong promoter in a variety of applications in gene transfer studies and drives the gene expression most actively in rapidly dividing cells (Cornejoet al., 1993). To investigate the function ofOsPIN2in rice, we made transgenic rice plants over-expressing the full length of cDNA driven by pUbi. Southern blotting analysis revealed that they came from two transgenic lines (O1 and O2, respectively) distinct from each other and both had one copy of the transgene (Figure 1a). Real-time RT-PCR analyses showed that transcriptional expression ofOsPIN2was moderate in the root–shoot junctions and roots but very faint in the leaves of WT (the untransformed plants as control) (Figure 1b). In both the transgenic lines, OsPIN2had the most abundant transcripts in the root–shoot junction, and similar levels in the leaves and roots (Figure 1b). The increases in OsPIN2transcriptional expression driven by pUbi in these tissues reached by 3–15 times. Over-expression ofOsPIN2significantly increased tiller angle and numbers and decreased height of the rice in comparison with WT (Figure 1i). At 80 days after germination (Figure 1c–j), O1 and O2 plants had a wider tiller angle (the angle between the outermost tillers in the left and right side) (44° and 48°, respectively) than the WT (22°) (Figure 1c). In addition, the two transgenic lines had many more tillers per plant (21 and 23, respectively) than the WT (17 on the average) (Figure 1d). In contrast, the whole plant height was very significantly decreased byOsPIN2over-expression (Figure 1e). The transgenic plant phenotypes were inheritable from T0 (Figure 2f–h) to T2 generations (Figure 2i–j). At the ripening stage (Figure 1j), theOsPIN2-over-expressing plants showed shorter panicle length, less number of grains per panicle and lower grain weight per panicle in comparison with the control (Table 1). Even though the seed setting rate was similar between O1, O2 and WT, O1 plants had a 35% increase in the effective tiller number, leading to a 16% grain yield increase per plant relative to control plants (Table 1). O2 plants showed the same tendency but not significant increase in panicle number and grain yield (Table 1). OsPIN2over-expression also decreased the grain length and breadth by 4%–7% and 12%–16%, respectively (Table 1). The changes in the grain size lead to 10%–12.5% decreases of 1000-grain weight compared to WT. Moreover, over-expression of the OsPIN2significantly decreased the number of adventitious roots and the total root length by 22%–28% (Table 2). To confirm that the changed phenotype of O1 and O2 was caused by over-expression of OsPIN2in the transgenic plants, we detected the location of one copy T-DNA insertion in these two lines. The T-DNA containing ubi-promoter was inserted in the chromosome 3 and 10 in the genome of O1 and O2, respectively (Figure 2). There was no putative gene in the insertion site for both O1 and O2. This direct genetic evidence further supported the OsPIN2 contribution to the altered phenotype of the transgenic rice in Figure 1

Auxin transport altered byOsPIN2over-expression in rice To assess whether the over-expression ofOsPIN2affected the free auxin levels, the concentration of endogenous free IAA in various organs of the transgenic and WT plants was quantified by high-performance liquid chromatography (HPLC). In the first and second leaves from the top, O1 and O2 transgenic plants contained free IAA concentrations that were 11%–35% lower than that in the control plants (Figure 3a). In the sheath of the first leaf, the transgenic plants and WT had nearly the same concentration of free IAA, while in the sheath of the second leaf, O1 and O2 plants had 38%–53% lower free IAA concentration than that in WT (Figure 3b). In contrast, in the root– shoot junction (shoot base), the two transgenic lines contained 65%–128% more free IAA than that in WT (Figure 3c). To detect the effect ofOsPIN2over-expression on auxin distribution, we separated individual roots into three segments: 0–4 cm including the root apex and elongation zones; 4–8 cm, the lateral root area; and 8–12 cm which was adjacent to the root–shoot junction. Both transgenic and WT roots showed the same patterns of free IAA concentration with an abrupt decrease from the tip to the root base (Figure 3d).

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

  1. Wang, J.R., Hu, H., Wang, G.H., Li, J., Chen, J.Y. and Wu, P. (2009) Expression of PIN Genes in Rice (Oryza sativaL.): tissue specificity and regulation by hormones. Mol. Plant, 2, 823–831.
  2. 2.0 2.1 Xu, M., Zhu, L., Shou, H.X. and Wu, P. (2005) A PIN1 family gene, OsPIN1, involved in auxin-dependent adventitious root emergence and tillering in rice. Plant Cell Physiol.46, 1674–1681.
  3. Abe, K., Takahashi, H. and Suge, H. (1996) Lazy gene (la) responsible for both an agravitropism of seedlings and lazy habit of tiller growth in rice (Oryza sativaL).J. Plant. Res.109, 381–386.
  4. Li, P., Wang, Y., Qian, Q., Fu, Z., Wang, M., Zeng, D., Li, B., Wang, X. and Li, J. (2007) LAZY1 controls rice shoot gravitropism through regulating polar auxin transport.Cell Res.17, 402–410.
  5. Yoshihara, T. and Iino, M. (2007) Identification of the gravitropism-related rice gene LAZY1 and elucidation of LAZY1-dependent and -independent gravity signaling pathways.Plant Cell Physiol.48, 678–688
  6. Yu, B., Lin, Z., Li, H., Li, X., Li, J., Wang, Y., Zhang, X., Zhu, Z., Zhai, W., Wang, X., Xie, D. and Sun, C. (2007) TAC1, a major quantitative trait locus controlling tiller angle in rice. Plant J.52, 891–898.

Cite error: <ref> tag with name "pmid:8219091" defined in <references> is not used in prior text.

Structured Information

Gene Name

Os06g0660200

Description

Similar to Auxin efflux carrier protein

Version

NM_001064803.1 GI:115469337 GeneID:4341736

Length

3804 bp

Definition

Oryza sativa Japonica Group Os06g0660200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:28077811..28081614

Sequence Coding Region

28077886..28078901,28078996..28079180,28079269..28079572,28080611..28080696,28080796..28080953
,28081075..28081151,28081241..28081307

Expression

GEO Profiles:Os06g0660200

Genome Context

<gbrowseImage1> name=NC_008399:28077811..28081614 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:28077811..28081614 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgatcaccggacgcgacatctacgacgtgctggcggcgatcgtgccgctgtacgtggcgatgttcctggcgtacgggtcggtgcggtggtgggggatattcacgccggaccagtgctccggcatcaaccgcttcgtcgccgtcttcgccgtgccgctcctctccttccacttcatctccaccaacgacccctactccatgaactaccgcttcctcgccgccgactcgctccagaagctcgtcatcctcgccgcgctcgccgtctggcacaacctgctctcccgctaccgccgcaatggcggcgccgccgcgtcgctcgactggaccatcaccctcttctcgctgtccacgctgcccaacacgctggtcatgggcatcccgctgctccgcgccatgtacggcgacttctccggctcgctcatggtgcagatcgtcgtgctccagagcgtcatctggtacaccctcatgctcttcctcttcgagtaccgcggcgccaaggcgctcatctccgagcagttcccgccggacgtcggcgccagcatcgcctcgttccgcgtcgactccgacgtcgtctcgctcaacgggagggaggcgctgcaggcggacgccgaggtggggcgcgacggccgcgtccacgtcgtcatccgccgctccgcctcggcctccaccacgggcggcggcggcggcgcggcgcgctccggcgtgtcccgggcgtacggcgcgtccaacgccatgacgccgcgcgcctccaacctcaccggcgtggagatctactcgctgcagacgtcgcgcgagcccacgccgcgggcgtccagcttcaaccaggccgacttctacgccatgttctccggcagcaagatggccagccagatggctagccccatggcgcagcacggcggcgccggcggccgcgcccagggcctcgacgagcaggtcaccaacaagttcgcctccggcaaggccgccgacccgccgtcgtatcccgccccgaaccccggcatgatgccggcgccaaggaagaaggagctcgggggctcaaactccaactccaacaaggagctacacatgttcgtgtggagctctagcgcgtcgccggtgtcggaggccaacctccgcaacgccgtcaaccacgccgcctccaccgacttcgcctccgcgccgccgccggcagccgttcccgtcggcggcgccactcccaaaggggtgagtggcagtgtcacgccggcggcgaagaacggcggcggcgagttggagatcgaggacgggctgaagagcccggcggcggggctggcggcgaagttcccggtgtcggggtcgccgtacgtggcgccgaggaagaagggcggcggcgccgacgtgcccgggctggcggaggcggcgcacccgatgccgccgacgagcgtgatgacgcggctcatcctcatcatggtgtggcgcaagctcatcagaaaccccaacacctactccagcctcatcggcctcgtctggtccctcgtctccttcaggtggaatatccaaatgccttcaataataaagggctcaatatcaatattgtcagatgcagggctaggaatggctatgttcagcttaggcttgttcatggctctgcaaccaaagatcatttcttgtggcaagaccgttgcgacatttgcaatggcagtgaggttcttgactggtccagctgttattgcagctacttccattgccattgggctcaggggagtactcttgcatgttgccattgttcaggcagcacttccacaaggcattgtcccgtttgtgtttgccaaggagtacaattgccatcctcaaatacttagcacagcggttatttttgggatgctcatcgcgcttccgatcacgatactctactatgtgcttcttgggatatag</cdnaseq>

Protein Sequence

<aaseq>MITGRDIYDVLAAIVPLYVAMFLAYGSVRWWGIFTPDQCSGINR FVAVFAVPLLSFHFISTNDPYSMNYRFLAADSLQKLVILAALAVWHNLLSRYRRNGGA AASLDWTITLFSLSTLPNTLVMGIPLLRAMYGDFSGSLMVQIVVLQSVIWYTLMLFLF EYRGAKALISEQFPPDVGASIASFRVDSDVVSLNGREALQADAEVGRDGRVHVVIRRS ASASTTGGGGGAARSGVSRAYGASNAMTPRASNLTGVEIYSLQTSREPTPRASSFNQA DFYAMFSGSKMASQMASPMAQHGGAGGRAQGLDEQVTNKFASGKAADPPSYPAPNPGM MPAPRKKELGGSNSNSNKELHMFVWSSSASPVSEANLRNAVNHAASTDFASAPPPAAV PVGGATPKGVSGSVTPAAKNGGGELEIEDGLKSPAAGLAAKFPVSGSPYVAPRKKGGG ADVPGLAEAAHPMPPTSVMTRLILIMVWRKLIRNPNTYSSLIGLVWSLVSFRWNIQMP SIIKGSISILSDAGLGMAMFSLGLFMALQPKIISCGKTVATFAMAVRFLTGPAVIAAT SIAIGLRGVLLHVAIVQAALPQGIVPFVFAKEYNCHPQILSTAVIFGMLIALPITILY YVLLGI</aaseq>

Gene Sequence

<dnaseqindica>76..1091#1186..1370#1459..1762#2801..2886#2986..3143#3265..3341#3431..3497#aattagctcgttctcttgtgtcaagaaaaaaaaagaaagaaaaagctcgccgccgccgccaccgtcgccggcgcgatgatcaccggacgcgacatctacgacgtgctggcggcgatcgtgccgctgtacgtggcgatgttcctggcgtacgggtcggtgcggtggtgggggatattcacgccggaccagtgctccggcatcaaccgcttcgtcgccgtcttcgccgtgccgctcctctccttccacttcatctccaccaacgacccctactccatgaactaccgcttcctcgccgccgactcgctccagaagctcgtcatcctcgccgcgctcgccgtctggcacaacctgctctcccgctaccgccgcaatggcggcgccgccgcgtcgctcgactggaccatcaccctcttctcgctgtccacgctgcccaacacgctggtcatgggcatcccgctgctccgcgccatgtacggcgacttctccggctcgctcatggtgcagatcgtcgtgctccagagcgtcatctggtacaccctcatgctcttcctcttcgagtaccgcggcgccaaggcgctcatctccgagcagttcccgccggacgtcggcgccagcatcgcctcgttccgcgtcgactccgacgtcgtctcgctcaacgggagggaggcgctgcaggcggacgccgaggtggggcgcgacggccgcgtccacgtcgtcatccgccgctccgcctcggcctccaccacgggcggcggcggcggcgcggcgcgctccggcgtgtcccgggcgtacggcgcgtccaacgccatgacgccgcgcgcctccaacctcaccggcgtggagatctactcgctgcagacgtcgcgcgagcccacgccgcgggcgtccagcttcaaccaggccgacttctacgccatgttctccggcagcaagatggccagccagatggctagccccatggcgcagcacggcggcgccggcggccgcgcccagggcctcgacgagcaggtcaccaacaagttcgcctccggcaaggccgccgacccgccgtcgtatcccgccccgaaccccggcatgatgccggcgccaaggtaaaatgaaactgattattaacacctcaaaatttctgttcatcgatcgtgttttgatcgagttggatttttgattttgtcgccattgctacaggaagaaggagctcgggggctcaaactccaactccaacaaggagctacacatgttcgtgtggagctctagcgcgtcgccggtgtcggaggccaacctccgcaacgccgtcaaccacgccgcctccaccgacttcgcctccgcgccgccgccggcagccgttcccgtcggcggcgccactcccaaaggtactctctcatccatccattgacgcacacgacgacgatcacaccacatgtgttcaaggcttcgtctaatggtgcgtgcatgccacaggggtgagtggcagtgtcacgccggcggcgaagaacggcggcggcgagttggagatcgaggacgggctgaagagcccggcggcggggctggcggcgaagttcccggtgtcggggtcgccgtacgtggcgccgaggaagaagggcggcggcgccgacgtgcccgggctggcggaggcggcgcacccgatgccgccgacgagcgtgatgacgcggctcatcctcatcatggtgtggcgcaagctcatcagaaaccccaacacctactccagcctcatcggcctcgtctggtccctcgtctccttcaggtattggattctcaccgatgttttcggtactcaagctgacgttctcgcttccacagttccacttcatcgacgcccgctttcccggtcgcttccctctaagatggaacactcttctgccaatacattttgacatcccacagctatgacagatcgcttatcccggttcatcttcagggcaagggcgctttttttcaagttataccgaattatcaaaacagattatttactctccatttcaaaaaagtattttataaaaaaaaatattcttctactacattacttagattacttgttttaagctagttgttaagtttttttttaaattgtttaatttatttgtataatgaaatcgataatctgcatagtaatctaaaccaaataagtaatatacacttgagttcacgatctgatcaatttatgttgttcgaagctacaaaaaggatatatttttgctatgctattcgttgctagattgcttgaaattttaatctaggaagaggcaagatcgatgagaacttacttaacttcacaactggattagtgttttctgaacgcatgtgagagcacatgataattacgttggtctcggatctggtccagcacatgcaaagaacatacacacgtatgcagatgcaggtgcaggtgcaggtcttatgtgagccctggagtttagcagcagagaccaaatctaccgaatcagctgcgattgccgtgtttgtccccatccaagacagacacggcgaattcggctcaactagctagatgatccatcatgtgtacaagaagaagagcaaaaaatgtacaatgatatggatgcatcattgattcattgtactactatcttaccattagatggcacatctagagggagggttgcaagaacagggcatttttagtggggaggagcacatgcctgcaagcatctaaaattgcatacatgcatgatacatctagcattgattctcttgtcatacaatttttttttacattgtgaaaatatatgcttaattgcttattgactttgtgaatttggatcaggtggaatatccaaatgccttcaataataaagggctcaatatcaatattgtcagatgcagggctaggaatggctatgttcagcttaggtacagagttgacctttttgatacatatctatagccataactagtgagttttttctttgctttgaccaagaaattctgacaatagtatatgtaacccaggcttgttcatggctctgcaaccaaagatcatttcttgtggcaagaccgttgcgacatttgcaatggcagtgaggttcttgactggtccagctgttattgcagctacttccattgccattgggctcaggggagtactcttgcatgttgccattgttcaggtaagcagtagattctttatttcttgcaatcatcttaaaagaaaaaaaatattaaattttgtaattatggtgaattggaatgtattgtggtgatcttatagattaattgattgtcaaacaggcagcacttccacaaggcattgtcccgtttgtgtttgccaaggagtacaattgccatcctcaaatacttagcacagcgtaagaaatgcatgcttaaactttctatttgttcgtccatacggttgctgaagtatatagcctaaaatatataaatgtgaaattttcagggttatttttgggatgctcatcgcgcttccgatcacgatactctactatgtgcttcttgggatatagtgttcttgaagaaggcaaaaaagaaagagtagggaaaaaaataggattctaggtttctagaggaaaatgcaaaagaaatatgatatgggctttcttgaagacctgaagaactaccagagctgaagaatagggaaatgagatcaagtaggatcctagctagagagaaatgcaaaggaaagacaccccttgattacaattttttaattttttctgcaactgttttggcatcaaagtaaaggttagggccttgagtatgaagagttcagccgttaatttgacaagttgggttggcggtactaaagattcc</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0660200, RefSeq:Os06g0660200