Difference between revisions of "Os12g0189500"

From RiceWiki
Jump to: navigation, search
(Evolution)
Line 26: Line 26:
  
 
===Evolution===
 
===Evolution===
Phylogenetic tree of Trp decarboxylases and sequence homologues: sequences were obtained by BLASTp search of proteomes of Rice (Os), Arabidopsis (At), Sorghum (Sb) and Poplar (POPTR) <ref name="pmid: 22025721">. In addition, sequences of experimentally characterized TDCs from Catharanthus roseus (CatroTDC), Camptotheca acuminata (CaTDC1, CaTDC2), Ophiorrhiza pumila (OpTDC), TyDCs from Papaver somniferum (PapsoTYDC1, PapsoTYDC2) and Petroselinum crispum (PetcrTYD) and phenylacetaldehyde synthases from Petunia hybrida (PetuniaPAAS) and Rosa hybrid cultivar (RosaPAAS) were included. The tree was rooted with the putative TDC/TyDC from Chlamydomonas reinhardtii (Cre01.g028423). Multiple sequence alignments were carried out using MUSCLE (Edgar 2004); trees were constructed using PROTDIST and FITSCH; bootstrapping was conducted using SEQBOOT.
+
Phylogenetic tree of Trp decarboxylases and sequence homologues: sequences were obtained by BLASTp search of proteomes of Rice (Os), Arabidopsis (At), Sorghum (Sb) and Poplar (POPTR) <ref name="pmid: 22025721" />. In addition, sequences of experimentally characterized TDCs from Catharanthus roseus (CatroTDC), Camptotheca acuminata (CaTDC1, CaTDC2), Ophiorrhiza pumila (OpTDC), TyDCs from Papaver somniferum (PapsoTYDC1, PapsoTYDC2) and Petroselinum crispum (PetcrTYD) and phenylacetaldehyde synthases from Petunia hybrida (PetuniaPAAS) and Rosa hybrid cultivar (RosaPAAS) were included. The tree was rooted with the putative TDC/TyDC from Chlamydomonas reinhardtii (Cre01.g028423). Multiple sequence alignments were carried out using MUSCLE (Edgar 2004); trees were constructed using PROTDIST and FITSCH; bootstrapping was conducted using SEQBOOT .
  
 
Phylogenetic tree of FMOs from rice (Os), Arabidopsis (At), Selaginella (Smoe), Physcomitrella (Ppls) and Chlamydomonas (Cr/Cre). Human FMOs, translated Pinus cDNAs and four sequences from bacteria, representing the most closely related proteins to YUCCA from outside the plant kingdom were also included. Multiple sequence alignments were carried out using MUSCLE (Edgar 2004); trees were constructed using PROTDIST and FITSCH bootstrap values for major branches are indicated. Scale bar indicates 0.1 amino acid substitutions persite<ref name="pmid: 19117763" />. Examination of the expression of YUCCA in developing seeds using both RT–PCR and microarray data indicated that OsYUC11 and AtYUC10 appeared to be specific to, and highly expressed in, endosperm tissue. These two proteins are orthologues of each other and also of ZmYUC, which appears to be important for IAA synthesis in developing maize kernels.
 
Phylogenetic tree of FMOs from rice (Os), Arabidopsis (At), Selaginella (Smoe), Physcomitrella (Ppls) and Chlamydomonas (Cr/Cre). Human FMOs, translated Pinus cDNAs and four sequences from bacteria, representing the most closely related proteins to YUCCA from outside the plant kingdom were also included. Multiple sequence alignments were carried out using MUSCLE (Edgar 2004); trees were constructed using PROTDIST and FITSCH bootstrap values for major branches are indicated. Scale bar indicates 0.1 amino acid substitutions persite<ref name="pmid: 19117763" />. Examination of the expression of YUCCA in developing seeds using both RT–PCR and microarray data indicated that OsYUC11 and AtYUC10 appeared to be specific to, and highly expressed in, endosperm tissue. These two proteins are orthologues of each other and also of ZmYUC, which appears to be important for IAA synthesis in developing maize kernels.

Revision as of 14:36, 3 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. The increase in IAA content was strongly correlated with the expression of putative IAA biosynthesis genes, OsYUC9, OsYUC11 and OsTAR1, measured by quantitative reverse transcriptase polymerase chain reaction[1]. These results confirm the importance of the tryptophan aminotransferase/YUCCA pathway in this system. All three genes were expressed in endosperm; expression of OsYUC11 appeared to be confined to endosperm tissue[2]. Phylogenetic analysis indicated that OsYUC11 and AtYUC10 belong to a separate clade of YUCCAs, which do not have orthologues outside the Angiosperms[3]. This clade may have evolved with a specific role in endosperm. Expression of tryptophan decarboxylase in developing rice grains did not correlate with IAA levels, indicating that tryptamine is unlikely to be important for IAA synthesis in this system[4]. In light of these observations, we hypothesize that IAA production in developing rice grains is controlled via expression of OsTAR1, OsYUC9, OsYUC11 and that IAA may be important during starch deposition in addition to its pr eviously suggested role early in grain development.

Expression

Quantitative RT–PCR results for OsYUC3, OsYUC 9, OsYUC 11, OsYUC 12, OsYUC 14, OsTAR1, OsTAR2 and OsTDC1. Total RNA was extracted using a Qiagen RNeasy Kit. Reaction tubes were prepared using a CAS-1200 Robotic liquid-handling system, Qiagen. Each tube contained 250 ng RNA per 25 μL reaction and a final primer concentration of 0.5 μM. Amplification was carried out using a Qiagen QuantiTect SYBR Green RT–PCR kit in a Corbett Research Rotor-Gene 3000 thermocycler fitted with a 72-tube rotor for 45 cycles. Expression was calculated relative to reference genes UBC using ROTORGENE software (Qiagen) [5]. Melt curve analysis confirmed that a single product was obtained for each gene amplified. Results shown are the means ± the standard error of three biological replicates and two technical replicates. Comparison of the expression of YUCCA, TAA/TAR and TDC orthologues during grain/seed development [6].


Evolution

Phylogenetic tree of Trp decarboxylases and sequence homologues: sequences were obtained by BLASTp search of proteomes of Rice (Os), Arabidopsis (At), Sorghum (Sb) and Poplar (POPTR) [7]. In addition, sequences of experimentally characterized TDCs from Catharanthus roseus (CatroTDC), Camptotheca acuminata (CaTDC1, CaTDC2), Ophiorrhiza pumila (OpTDC), TyDCs from Papaver somniferum (PapsoTYDC1, PapsoTYDC2) and Petroselinum crispum (PetcrTYD) and phenylacetaldehyde synthases from Petunia hybrida (PetuniaPAAS) and Rosa hybrid cultivar (RosaPAAS) were included. The tree was rooted with the putative TDC/TyDC from Chlamydomonas reinhardtii (Cre01.g028423). Multiple sequence alignments were carried out using MUSCLE (Edgar 2004); trees were constructed using PROTDIST and FITSCH; bootstrapping was conducted using SEQBOOT .

Phylogenetic tree of FMOs from rice (Os), Arabidopsis (At), Selaginella (Smoe), Physcomitrella (Ppls) and Chlamydomonas (Cr/Cre). Human FMOs, translated Pinus cDNAs and four sequences from bacteria, representing the most closely related proteins to YUCCA from outside the plant kingdom were also included. Multiple sequence alignments were carried out using MUSCLE (Edgar 2004); trees were constructed using PROTDIST and FITSCH bootstrap values for major branches are indicated. Scale bar indicates 0.1 amino acid substitutions persite[8]. Examination of the expression of YUCCA in developing seeds using both RT–PCR and microarray data indicated that OsYUC11 and AtYUC10 appeared to be specific to, and highly expressed in, endosperm tissue. These two proteins are orthologues of each other and also of ZmYUC, which appears to be important for IAA synthesis in developing maize kernels. You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.


Present address: Department of applied biological science, Al-Ghad International AppliedMedical Science University, Jeddah, Saudi Arabia

References

  1. Bandurski RS, Schulze A (1977) Concentration of indole-3-acetic acid and its derivatives in plants. Plant Physiol 60: 211–213.
  2. Barkawi LS, Tam YY, Tillman JA, Pederson B, Calio J,Al-Amier H, Emerick M, Normanly J, Cohen JD (2008) A high-throughput method for the quantitative analysis of indole-3-acetic acid and other auxins from plant tissue. Anal Biochem 372: 177–188
  3. Benedito VA, Torres-Jerez I, Murray JD, Andriankaja A,Allen S, Kakar K, Wandrey M, Verdier J, Zuber H, Ott T,Moreau S, Niebel A, Frickey T, Weiller G, He J, Dai XB,Zhao PX, Tang YH, Udvardi MK (2008) A gene expression atlas of the model legume Medicago truncatula. Plant J 55: 504–513.
  4. Chen KH, Miller AN, Patterson GW, Cohen JD (1988) A Rapid and simple procedure for purification of indole-3-acetic-acid prior to GC-SIM-MS analysis. Plant Physiol 86: 822–825
  5. Jain M, Nijhawan A, Tyagi AK, Khurana JP (2006) Validation of housekeeping genes as internal control for studying gene expression in rice by quantitative real-time PCR. Biochem Biophys Res Commun 345: 646–651.
  6. Jain M, Nijhawan A, Arora R, Agarwal P, Ray S, Sharma P, Kapoor S, Tyagi AK, Khurana JP (2007) F-box proteins in rice. genome-wide analysis, classification, temporal and spatial gene expression during panicle and seed development, and regulation by light and abiotic stress.Plant Physiol 143: 1467–1483.
  7. Cite error: Invalid <ref> tag; no text was provided for refs named pmid:_22025721
  8. Zhang H, Tan GLL, Yang LNN, Yang JC, Zhang JH, Zhao BH (2009) Hormones in the grains and roots in relation to post-anthesis development of inferior and superior spikelets in japonica/indica hybrid rice. Plant Physiol Biochem 47: 195–204.


Please input cited references here.

Gene Name

Os12g0189500

Description

Pyridine nucleotide-disulphide oxidoreductase, class I family protein

Version

NM_001072867.2 GI:297612801 GeneID:4351695

Length

8650 bp

Definition

Oryza sativa Japonica Group Os12g0189500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 12

Location

Chromosome 12:4507750..4516399

Sequence Coding Region

4507750..4507887,4514763..4514909,4515209..4515331,4515422..4515658,4515788..4516399

Expression

GEO Profiles:Os12g0189500

Genome Context

<gbrowseImage1> name=NC_008405:4507750..4516399 source=RiceChromosome12 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008405:4507750..4516399 source=RiceChromosome12 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagaaggctctagttctgattgttggagcaggcccatctggtcttgcaacagcggcgtgccttggccagctctctataccctatgttattatcgagcgtgaggattgtaccgcgtcgctgtggcgtaagcacacatatgatcgcctcaagcttcacctcgcaaaggagttctgcgagatgccccacatgccatatccggaagacacaccaacctacatccccaagattcaatttttgaggtatatggatgattatgtggagcatttcaacatttgtcccaaatttaactcatctgttgagtcatgtttgtatgatgatgtgcaaaaatattgggttgtcacaacacatgaccaagtgaatggcatggtgtccaagtatgcagctaggttcttagttgtagcaagtggtgaaaatagtgcagggaacattcctagcatccctggactagaggatttctctggccatgtcatacactcatcaagctttaggtcagcagattcctatgctgcgcaaagggtgcttgttgttggatgtggaaactcaggcatggagattgcctatgatctttcaagccatggagcaaatacctccatagtcatccgcagccctctgcatgtgatgacaaaggagctgattcacatggggatgaaacttgcaagctggagcctcccagtgaaatttgttgattttattcttgtggtccttgcatatctctggtttggcaatctctcaaagtatggcatcgtgaggcccaataaggggccattgcttcttaaggcaaatactggtcggtcagcagtaatagatgttggcactgtggagttaataaagaaaggggatatcaaggtctttggtacaatatcttgcatcaagggaaatgttgttgaatttgatgatgggaaagaaagttactttgatgctattgtttttgctacaggctacacaagtactgcaaacaactggcttaagaatggtgaggatatgatgaacaaagaaggcatgcccaagaaggacttcccaaatcactggaaaggttcaaatggactctactgtgttgggtttgcgaggagaggattatctggtattgctcatgacgccaaaaacgttgctaatgactggatggaagaagacttgacaccaaagcccgccgttggcagttctaagaacagtcagccctcacttatcacatccatggatggtgaacgatgctttgccttagtggcagagcaaactgtttccattggaggcaattga</cdnaseq>

Protein Sequence

<aaseq>MEKALVLIVGAGPSGLATAACLGQLSIPYVIIEREDCTASLWRK HTYDRLKLHLAKEFCEMPHMPYPEDTPTYIPKIQFLRYMDDYVEHFNICPKFNSSVES CLYDDVQKYWVVTTHDQVNGMVSKYAARFLVVASGENSAGNIPSIPGLEDFSGHVIHS SSFRSADSYAAQRVLVVGCGNSGMEIAYDLSSHGANTSIVIRSPLHVMTKELIHMGMK LASWSLPVKFVDFILVVLAYLWFGNLSKYGIVRPNKGPLLLKANTGRSAVIDVGTVEL IKKGDIKVFGTISCIKGNVVEFDDGKESYFDAIVFATGYTSTANNWLKNGEDMMNKEG MPKKDFPNHWKGSNGLYCVGFARRGLSGIAHDAKNVANDWMEEDLTPKPAVGSSKNSQ PSLITSMDGERCFALVAEQTVSIGGN</aaseq>

Gene Sequence

<dnaseqindica>8513..8650#1491..1637#1069..1191#742..978#1..612#atggagaaggctctagttctgattgttggagcaggcccatctggtcttgcaacagcggcgtgccttggccagctctctataccctatgttattatcgagcgtgaggattgtaccgcgtcgctgtggcgtaagcacacatatgatcgcctcaagcttcacctcgcaaaggagttctgcgagatgccccacatgccatatccggaagacacaccaacctacatccccaagattcaatttttgaggtatatggatgattatgtggagcatttcaacatttgtcccaaatttaactcatctgttgagtcatgtttgtatgatgatgtgcaaaaatattgggttgtcacaacacatgaccaagtgaatggcatggtgtccaagtatgcagctaggttcttagttgtagcaagtggtgaaaatagtgcagggaacattcctagcatccctggactagaggatttctctggccatgtcatacactcatcaagctttaggtcagcagattcctatgctgcgcaaagggtgcttgttgttggatgtggaaactcaggcatggagattgcctatgatctttcaagccatggagcaaatacctccatagtcatccgcagccctgtaagtaaataatacatttgcataaaagtttcctttctttattttgcctccctgttttccaggtcaagttattgtaagtatcctattaaatcattttcttacaccacaaattcttgaattattctaaagctgcatgtgatgacaaaggagctgattcacatggggatgaaacttgcaagctggagcctcccagtgaaatttgttgattttattcttgtggtccttgcatatctctggtttggcaatctctcaaagtatggcatcgtgaggcccaataaggggccattgcttcttaaggcaaatactggtcggtcagcagtaatagatgttggcactgtggagttaataaagaaaggggatatcaaggtaacaaaattcttgacacaacatagaaaagtctatataaattctatttggtacttgacaggttctataaggaatttatgtggcatgtaggtctttggtacaatatcttgcatcaagggaaatgttgttgaatttgatgatgggaaagaaagttactttgatgctattgtttttgctacaggctacacaagtactgcaaacaactggcttaaggtatgtaatatgttgctcatatggtaaatagtaaatacaaaaattattgcaattagatttagttgttattttctctctcctgcatacctcaagtggggcatcaaattaagagtgcctacaatactattagacagatttagaaagaaaagcatttgcgtgattgactcaacaaaattagtgataaaacctgttataaaattatagttataattagaagacaatggtgctatcttcatatttaactttctttctttctgtggaaatatttgttaataaaataattatgattaaaaacgcagaatggtgaggatatgatgaacaaagaaggcatgcccaagaaggacttcccaaatcactggaaaggttcaaatggactctactgtgttgggtttgcgaggagaggattatctggtattgctcatgacgccaaaaacgttgctaatgacgtcaaggccttcctagatttgatggcaccattctaattattatttgcactggaatgatgcctatcaaatagtattgtggtaccttctacaatagtggtgtgtacttaatgttacattatgtttgaagcaagctaaatgttatgcaatctccagagttgtttaaataattatattttcttaatcgacatgttggatgagcttttatttaaagctctttgctggaatacatgaatatgtggtttattctttataatgtgtgaagccctttgtttggatccatgaaaaataaaatcagaaactcatgtcaaacctcccctcacacctgtattacctatcctactctaaatcataccccctcctccccccatcggcaccatagttgttcagccagtgacgccctgcccttttgaaagaagttgagcatcactgccggttcatggctgtttaggcgggaaaattcactccaacgccatgaactggtaaagattggcaatccctgttggctcacaccgaaccgatagagatcagtgggcaaggattgccctttctgtaccagtaacacctttatccactccagttatgaaaaaaaaatgctctttagagttgtttgttccttatttcaactcaacacaacaatatggagttctaaaaaataacacaacattatggagaatactaaataatagtagagatcatagattacttagaagttagaacatacctaaaagggagattttttttttaaaaaaagaattcattttcaatcctatgccttattttcactgacatttggaaagggagtagtatgtctatttggggaagaggttcttttttttttttggggggcggggggggggggggggagggggaagggagggctgctttgattaattcctcccattgtattacatttcacttggatggatcatacctcctattcttctagataccacgaacaaatgtcattgaattatgagatagactaaaatctgcgggtgtcaaagatttcagaaaacttgagtctttgatgtaaatgttggtggaaattgcacccttttatatcaaatgcccattgggtttgtgcagctagcctaaaaaagattattccccattttggaaggttatgtgttacaaatcagacatctccgcaatattttcagaaaactaaagtgggtactaatactatatttttgcatgatcctggcctaaggtggtattacaatctgttgagatatgcaatggtcaaagagtggtactgtacattctattagagagctagattttattttgaactctagatgtgggtaactgatgatactggattgacgaaagccgaaagcccatctttatgagttttttaaggacttggtaggatcaatatataaacttttaataggagaaaatgtacatttactataaccaatttttacatgacgcctcgacaggaggcacccctcccctaggcatgcctctaaagttagccctgttagtgttctatcccttttgagcagaccattcttgagtaggttacaaatgtcacactgtttgatactccatttgtcctaaaatataaggtggccatatatagttttagcaaaaccaacatatgtaggttttgacaaataacaaactaacaatatactgtatatgtttaatgccatccatttcatatcctaagattcatatttgaaagcactcttgtatgatgtaattttctagttcttgataatatattattgaagaaactaattgttaaaatataatattgtagacagtgtaagaaaactaatatgctttatagtttgagactgataggactattataaaaaggtcctcctattacacttgatgagaatgatggtaaaattgcatgatatataatttgtgaaagctggcacatattcaatgaaatcgatatattctttggatgatcacgggtgtttctgggccaaatttctactttatttgtaatcccgagagcttcatctacaagtaaaaaaaaaatccaggtttttagttgataatgtagtctatcttaataaaggaagagatgcaaaggaggaaatttcctgcaaacaccggaatgtcttttcttccctgactgaaaatacagttttgttctttacatgtaaattagctagcaaagttatttaggggcattacaggtttagatatgctttggcaccaaaaccaggtacagaacaaatgttcgctggatgcactgcatcgatcttgatgtactccctatgttcaattatataagacatttttggtttgttctaatcaaacttgaatatacatattttcagtttgaccaaacaatgtagtagtgtttccaacacaaaacaaatatactacagaaatatatttaatggtggatttaatgaaaccaataaagagtatgcgataatagtaagtccatctaatgcataaaatcctggtgcattactatcctaggttaatatggcaccacctatactaagatcttcttctttctcttcatgtttgattgtacatcttgatatttccttccatgtgcatgcatggtttcaacaaaaaaaaaggtaacactgacttgttccaataatacacattgtagttatctatagcccttttttacatacatattacccccattatgtttgcagttgttacccccctttatctgattagagcataaaggacctgtggaatttttactcttataacccgactttttttatctattccataacctacaaatgggtttcctattttgatttgtaaaaataacaaagagaaagcctttgctctgatggtcacaatccttcgatttattccttttgtttgtaataatgttagtaaagtaatccatcagttgatttataaccccctctcgccaatgaaactgattcacttttatgaagtgaggagaaagaagggatcaattaatcgaggatccaatattttagtccctcgaggaagtctcctaaatcattggtagtattcatttgactctactagttacaactaataagacatatttataagaaagaaaatgcagcaggaggattactgatttcaattagttactatgtgcaaaattcagtgctcgcgtgccggggggggggggggaggggcggcaacggagttattgttcctacatacaataaatagtgatgacatgctctagtgaagttatttcagactggatccacatgggtgtctttcttttgtttctttggaaaggcttgttgtagctatctcatcttgataggtcgaaagattcgttcgttagtaacgacttgcttaaacaaagttactccaattttggtccatgtgcatgcatcttaattttttttcttttgttttgaaatccggttgtcatagccatctcaatataggccaaaataagtttttttggtgtttctttccttattagccctaaaaataggcgacaaatgtccaaaattgcaccactgacctataaggatgggcccctagctaagaattaggtgcgactgagacgaggtaaagacctatatatatactaagacatgtaacaccttttttatttttctatttggaaatattcttttccctatttcataggaatgaactaaatttcaaaaaagaaaaagcacacaattactacaaaaaagtatgtgattgaaccattgaccaaagatggcgattattgtctttttcacttggcaaagtaggcaacataatccatctctcggccgccgcttggccatgtcaaactggcttagtgataaaggtcatccccttcgtcgattggctcacaagtgctagaaaaaggggaaaataggacatggcctttggcaggatgtgtttgttgtgtacttgcggtgtgggcggaaagtacaagaagcatgataattgggctgttcagtacataccgatgagtgaggcaacttgaggtagacaaagcaatgaagtgtatggctttggtggtaagattgagtagcctcgtcctccacatttgggtgaacaacaatgcttgatacatgaatatagaaaaagcattggacaatatgcataatggcatgaggcaataacactaacaagccacattgtagactgagatatatattgagtaccacaaccttgttgtaggtagcaaggtcagaacaacactgcaatacattgaaagacataattgactatctttcttggaattatgagcatgttgatacacattccactacagaacaaccattgttcttcaattacctgaataatttgatcctggcccattactggaaaaaataagatggatgagattgcatgcagtcatagttagtgctctggctaggttgctcgtgccaccaagatgcgagattagcacccgagagagtataatgtgtgaaggcacttcctgtgagctgagcctaagggagattacagtgcgtgaagttgcatctgaagtctcaggtctctcgcccacttatggttttgcataatcttcaggacttaacatatgtacctgatgcaagttcagctttgtagaagcataaaatatatgtgacacaagttcaatatgggcgcaactaaaaaacacaatactaactaattaaaagacgcttaattcttttgttcatcaagtctttgtaagagaacttgtcgatgcaaaaaaacataccaaatttggtcgttaacagaactgtacgaagtctttttcatgagagtttaagctaatgagatggctaataagcgagtgacctagtgcttatttctctgtgtcatattcagttgtgtgcgtggatgtatcacgtgacaagtgtttcgctcaacaacaatggtacatatatccaaatgacatagaatatgttgcttgaataaaacataactgatactcgcccaattggaaaattagtcaccgaagccctaccacagttggttttgttttgtacttttatttgagagaaatcaagagatagacaaggataaaagagtgaccagagcgatggtgattatagtgttaaattgtcgttaggaaatcactcaatgtttaaggggctgtttggttcatgatcctggtgaaaaggagcctggcctaatccctccctgtcacatggttgagtgttgtttggttcaaaggcctaaaggattttcaggatgcctgacttgaaccactgccttgcatcctttagcctgcgtccggcttcccattttggagctggcccgagcttcaggcacgtcaactccatgcatgcagttgcttgcgacattgtggtcggaataaaaaatttggcaatagtcccatctatattgattaaatcggaagtatgagcttgttttgattttgattcaaatccttagtttttttcctctaaattaatacttgttaattgctataattgaggagtacgagtttatcagtgttcattgttactgatagacaagagataatcgatgaatgatgaatcttccataacttaggtaagtgttttaccaacatatgtagtgtagtaaaaaaatgaattcaaccctttcgtgcttactataactaattaatttggttttctatttgctcctttaactctaaccctagctctatttattggcttgaacaaggtacatcttatttgaaatgaattgaatgaataaggcaaaaaagaaaaaaaatcattcttttggattcctggtatcctacaactctttttcacactacttacaaattctttttttcttggtcatggataaggctatacataaaatcaatgaatacgttaatatgtatctattaagttgatacatatcttaattaccaatgtgtaatcttgaactcaggctttcctagtcaagcatattttaccaaattctcaagtagctctcagacatacgtttttatcaatcatgttgctcaggtcactaaccaaacaagccctaagttgcaagaacacaaacacgactgatttcgtcaatgagcccaagtcgttggtgtttttaccagatgactcatcactatcggttcctttagagatgacactgatatcactgatggttcgtaattaattaacaagaaattactatgatacttaagtttccactaatgtatcacggttagttcataacaacaaccagcaccgatattcaatggaccagacctcaatggatcggatcatattcaagactatcatgtccattgagtatcaaactatatgtcattagtactcaaatgataatttgaaagaaaatggtaactttttcataagtcaggtgaagacaaacattatgtaaaagtatatagtttaaccaaagctacagctttgtagttgatgattttttgatttttgagattgtttacatgcccaagttgtcaaatctactcggacaaattttttgatattcccaaatgtccttggattgagactaactctacataaaaattggcgacacgatctattaatttttagttgacaatattttcattgtaagtcatttatatgcccgaatatatgttagaagtgttggctctatttggataaacgaaattttaaaatttttcaacgacttcagacaaacatgaactctatatggaagttgtggagatcgatgagatctacagatttgtcattgaagaccgaaaataatagcataagctatttaggcaaaaagagcattatagttgagatgggaggctgtggagatatagttgatcctatgtttgaatcctatgtacctcacacgcacgtacttcatgtgagaaatcatgtgaattgtgatttgtgatgtgtgtagatacttgatacgaaatacttttccaagtttttcatcgtggagagaattcaaaacccggtgcacaactatcaaatacatgttgatgtctttttgttgttctaactagtattaattgttcttaaataaagtggatggaagaagacttgacaccaaagcccgccgttggcagttctaagaacagtcagccctcacttatcacatccatggatggtgaacgatgctttgccttagtggcagagcaaactgtttccattggaggcaattga</dnaseqindica>

External Link(s)

NCBI Gene:Os12g0189500, RefSeq:Os12g0189500