Difference between revisions of "Os05g0349700"

From RiceWiki
Jump to: navigation, search
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
 
 
Yellow-green leaf1 (ygl1), was isolated, which showed yellow-green leaves in young plants with decreased Chl synthesis, increased level of tetrapyrrole intermediates, and delayed chloroplast development.The mutant plant exhibits a yellow-green leaf phenotype, decreased level of Chl, and delayed chloroplast development.
 
Yellow-green leaf1 (ygl1), was isolated, which showed yellow-green leaves in young plants with decreased Chl synthesis, increased level of tetrapyrrole intermediates, and delayed chloroplast development.The mutant plant exhibits a yellow-green leaf phenotype, decreased level of Chl, and delayed chloroplast development.
 
===Expression===
 
===Expression===
Please input expression information here.
 
 
Genetic analysis demonstrated that the phenotype of ygl1 was caused by a recessive mutation in a nuclear gene. The ygl1 locus was mapped to chromosome 5 and isolated by map-based cloning. Sequence analysis revealed that it encodes the Chl synthase and its identity was verified by transgenic complementation. A missense mutation was found in a highly conserved residue of YGL1 in the ygl1 mutant, resulting in reduction of the enzymatic activity. YGL1 is constitutively expressed in all tissues, and its expression is not significantly affected in the ygl1 mutant. Interestingly, the mRNA expression of the cab1R gene encoding the Chl a/b-binding protein was severely suppressed in the ygl1 mutant. Moreover, the expression of some nuclear genes associated with Chl biosynthesis or chloroplast development was also affected in ygl1 seedlings.
 
Genetic analysis demonstrated that the phenotype of ygl1 was caused by a recessive mutation in a nuclear gene. The ygl1 locus was mapped to chromosome 5 and isolated by map-based cloning. Sequence analysis revealed that it encodes the Chl synthase and its identity was verified by transgenic complementation. A missense mutation was found in a highly conserved residue of YGL1 in the ygl1 mutant, resulting in reduction of the enzymatic activity. YGL1 is constitutively expressed in all tissues, and its expression is not significantly affected in the ygl1 mutant. Interestingly, the mRNA expression of the cab1R gene encoding the Chl a/b-binding protein was severely suppressed in the ygl1 mutant. Moreover, the expression of some nuclear genes associated with Chl biosynthesis or chloroplast development was also affected in ygl1 seedlings.
 
===Evolution===
 
===Evolution===
Please input evolution information here.
 
 
The rice YGL1 was more closely related to Chl synthase from the monocotyledon plant oat than to those of other species. Not surprisingly, YGL1 has a phylogenetically much closer relationship to Chl synthases of the higher plant species than to bacteria proteins. In addition, it is interesting to note that bacteriochlorophyll synthases lack a motif (WAGHDF-197) that exists only in the Chl synthase. Analysis with the transmembrane calculation programs revealed that the ygl1 mutation site occurred at or close to the end of a transmembrane helix.
 
The rice YGL1 was more closely related to Chl synthase from the monocotyledon plant oat than to those of other species. Not surprisingly, YGL1 has a phylogenetically much closer relationship to Chl synthases of the higher plant species than to bacteria proteins. In addition, it is interesting to note that bacteriochlorophyll synthases lack a motif (WAGHDF-197) that exists only in the Chl synthase. Analysis with the transmembrane calculation programs revealed that the ygl1 mutation site occurred at or close to the end of a transmembrane helix.
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
 
 
   1.National Key Facility for Crop Gene Resources and Genetic Improvement, Institute of Crop Science, Chinese Academy of Agricultural Sciences, Beijing, China
 
   1.National Key Facility for Crop Gene Resources and Genetic Improvement, Institute of Crop Science, Chinese Academy of Agricultural Sciences, Beijing, China
 
   2.National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University, Nanjing, China
 
   2.National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University, Nanjing, China
 
==References==
 
==References==
Please input cited references here.
 
 
   1.Wu, Z., Zhang, X., He, B., Diao, L., Sheng, S., Wang, J., & Wan, J. (2007). A chlorophyll-deficient rice mutant with impaired chlorophyllide esterification in chlorophyll biosynthesis. Plant physiology, 145(1), 29-40.
 
   1.Wu, Z., Zhang, X., He, B., Diao, L., Sheng, S., Wang, J., & Wan, J. (2007). A chlorophyll-deficient rice mutant with impaired chlorophyllide esterification in chlorophyll biosynthesis. Plant physiology, 145(1), 29-40.
 
   2.Shalygo, N., Czarnecki, O., Peter, E., & Grimm, B. (2009). Expression of chlorophyll synthase is also involved in feedback-control of chlorophyll biosynthesis. Plant molecular biology, 71(4-5), 425-436.
 
   2.Shalygo, N., Czarnecki, O., Peter, E., & Grimm, B. (2009). Expression of chlorophyll synthase is also involved in feedback-control of chlorophyll biosynthesis. Plant molecular biology, 71(4-5), 425-436.

Revision as of 15:05, 3 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Yellow-green leaf1 (ygl1), was isolated, which showed yellow-green leaves in young plants with decreased Chl synthesis, increased level of tetrapyrrole intermediates, and delayed chloroplast development.The mutant plant exhibits a yellow-green leaf phenotype, decreased level of Chl, and delayed chloroplast development.

Expression

Genetic analysis demonstrated that the phenotype of ygl1 was caused by a recessive mutation in a nuclear gene. The ygl1 locus was mapped to chromosome 5 and isolated by map-based cloning. Sequence analysis revealed that it encodes the Chl synthase and its identity was verified by transgenic complementation. A missense mutation was found in a highly conserved residue of YGL1 in the ygl1 mutant, resulting in reduction of the enzymatic activity. YGL1 is constitutively expressed in all tissues, and its expression is not significantly affected in the ygl1 mutant. Interestingly, the mRNA expression of the cab1R gene encoding the Chl a/b-binding protein was severely suppressed in the ygl1 mutant. Moreover, the expression of some nuclear genes associated with Chl biosynthesis or chloroplast development was also affected in ygl1 seedlings.

Evolution

The rice YGL1 was more closely related to Chl synthase from the monocotyledon plant oat than to those of other species. Not surprisingly, YGL1 has a phylogenetically much closer relationship to Chl synthases of the higher plant species than to bacteria proteins. In addition, it is interesting to note that bacteriochlorophyll synthases lack a motif (WAGHDF-197) that exists only in the Chl synthase. Analysis with the transmembrane calculation programs revealed that the ygl1 mutation site occurred at or close to the end of a transmembrane helix.

Labs working on this gene

 1.National Key Facility for Crop Gene Resources and Genetic Improvement, Institute of Crop Science, Chinese Academy of Agricultural Sciences, Beijing, China
 2.National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University, Nanjing, China

References

 1.Wu, Z., Zhang, X., He, B., Diao, L., Sheng, S., Wang, J., & Wan, J. (2007). A chlorophyll-deficient rice mutant with impaired chlorophyllide esterification in chlorophyll biosynthesis. Plant physiology, 145(1), 29-40.
 2.Shalygo, N., Czarnecki, O., Peter, E., & Grimm, B. (2009). Expression of chlorophyll synthase is also involved in feedback-control of chlorophyll biosynthesis. Plant molecular biology, 71(4-5), 425-436.
 3.Wu, Z. M., Zhang, X., Wang, J. L., & Wan, J. M. (2014). Leaf chloroplast ultrastructure and photosynthetic properties of a chlorophyll-deficient mutant of rice. Photosynthetica, 1-6.

Structured Information

Gene Name

Os05g0349700

Description

Similar to G4 protein (Chlorophyll synthetase)

Version

NM_001061807.1 GI:115463344 GeneID:4338498

Length

5708 bp

Definition

Oryza sativa Japonica Group Os05g0349700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:16489882..16495589

Sequence Coding Region

16489959..16490073,16490176..16490223,16490311..16490396,16491175..16491262,16491771..16491856
,16491988..16492074,16492612..16492677,16492771..16492854,16492974..16493035
,16493136..16493211,16493290..16493352,16493444..16493525,16494224..16494300
,16494886..16494933,16495065..16495127

Expression

GEO Profiles:Os05g0349700

Genome Context

<gbrowseImage1> name=NC_008398:16489882..16495589 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:16489882..16495589 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccacctcccacctcctcgccgccgcctcctccaccgccgcctcctccgccaccttccgccctcccctcctcagcctccgctccccgccgccctcttctctccgcctcaaccgcaggcgccacttccaggtggtccgcgcggccgagaccgacaaagagacgaaggccaatgcgcccgagaaagctcccgcgggaggctccagcttcaaccagctgctcggcatcaagggcgccaagcaagagaacgacatatggaagattcgccttcaacttactaagccagtgacatggcctccgcttgtatggggagtgctttgtggagcagctgcctctggaaatttccactggacagttgaagatgttgcaaaatctattgtctgcatgataatgtctggtccatgtcttacaggatacacacagacaattaacgactggtatgatcgagatatagatgcgataaatgaaccttaccgtcctattccttcaggcgctatatcagaaaatgaggtcattactcaaatttgggcactgttgttagcagggcttggcctgggtgctctgttagatgtatgggcaggacatgattttcctattattttttatcttgctgttggtgggtccttgctttcttacatatattcagctccacctctgaagctcaagcagaatggatggattggaaactttgctcttggtgcgagctacattggcttgccctggtgggctggccaggcattatttggaacccttactcctgatattgttgtcctgacttctttgtatagcatagctgggctagggattgctattgtaaatgactttaagagtgttgagggagatagagctctggggcttcagtcactcccggttgcttttggtatggaaactgcaaagtggatatgtgtaggagcgattgacataactcaattatccgttgcaggctaccttttcagttccggcaagccttattatgccctggcactgctaggactcacaattcctcaggtggtctttcagttccaatacttcctcaaggaccctgtgaagtatgacgtcaaataccaggcaagcgcgcaaccgttcttcgtcttgggccttctggtgaccgcccttgcaaccagccactga</cdnaseq>

Protein Sequence

<aaseq>MATSHLLAAASSTAASSATFRPPLLSLRSPPPSSLRLNRRRHFQ VVRAAETDKETKANAPEKAPAGGSSFNQLLGIKGAKQENDIWKIRLQLTKPVTWPPLV WGVLCGAAASGNFHWTVEDVAKSIVCMIMSGPCLTGYTQTINDWYDRDIDAINEPYRP IPSGAISENEVITQIWALLLAGLGLGALLDVWAGHDFPIIFYLAVGGSLLSYIYSAPP LKLKQNGWIGNFALGASYIGLPWWAGQALFGTLTPDIVVLTSLYSIAGLGIAIVNDFK SVEGDRALGLQSLPVAFGMETAKWICVGAIDITQLSVAGYLFSSGKPYYALALLGLTI PQVVFQFQYFLKDPVKYDVKYQASAQPFFVLGLLVTALATSH</aaseq>

Gene Sequence

<dnaseqindica>78..192#295..342#430..515#1294..1381#1890..1975#2107..2193#2731..2796#2890..2973#3093..3154#3255..3330#3409..3471#3563..3644#4343..4419#5005..5052#5184..5246#gggtcaaaaacatcgcgttatccttccctcctctcgcctcggtggtgtgcgtcttccccacccacccccagtctccaatggccacctcccacctcctcgccgccgcctcctccaccgccgcctcctccgccaccttccgccctcccctcctcagcctccgctccccgccgccctcttctctccgcctcaaccgtactgcctccccctcagttccctctctctctctctagcttcttgttcttgcagctagccccgctgtgtgtggctgatgcgtctgagctcctccattcgcaggcaggcgccacttccaggtggtccgcgcggccgagaccgacaaagagagtaagctcgggcgtctccctgtttgttcgattgatttctatggcgttttcgggttttcctaatgtgcggtttgggttggctgcgcagcgaaggccaatgcgcccgagaaagctcccgcgggaggctccagcttcaaccagctgctcggcatcaagggcgccaagcaagagaacgtgagtctcccatcccgctcccttgcgctacgttctaatctggttgcagaatgcatatagagcactgggcactggggttttagcagcatatagagcgctgcatatatgcatgggcattgagcatgtcctacactgggttcttggtgtgtgctgtagcgggattgccgatgcgctacccagtggcgtcctcctcgaaaatttcctgtttttggatgccatacatggccctttctctacctttttgggagagcattggagcatttttcacaaatgttatatgcagctgcggcttatgatgccacgccggcgcacgccctaccttaccgcgttgttgttgtttgggtcattttagttatgtgtatactagctaggtgccttgaccaagttatggacattcatgccgttcgttcttcaatagattgatgattagtgatacgctttgctctatgcatctttcttgtttgtagtagttcgcagtttttgttaaggcaatagacgattctccagattgtgacaagtttagtactaatggctcatgttgtggaaggcttggaatgtcgatacataatcattcaaaatagaaaataggatttcaatttgaagcattccttagtttgcaagcttttcccccaaaaccatgttttaagcactctacttcacatttctagaagctgataagatatgcatctttttctctttttgcaatcaatatgttcatgtatggaaacaactaatgctatattgctaatcaattaactctttcacatggtgcatataggacatatggaagattcgccttcaacttactaagccagtgacatggcctccgcttgtatggggagtgctttgtggagcagctgcctctggtatgcctatggtacctttcgttgattttatctgtttggagagtttattcttctacttcctaataatcatttgagcacctgtagaattggtaaactactttttttactttataatcatgtgtgcctgtcactacattgcaagcattcataagacctaatcaacggtttaaaagtgtgcatcgtccctaaatgatgaatttactgaaccctagtaattttactgtgttgccaatttgcataatttacaagatctgtaggtctgcaacttattttgtgatgaagttacttcctgattatcgctgtattagagtggaatcagccaaaagattgaatatatgtgggctaggctctatgcgagataagtccagccaaaagagttctttagggtggcaatggcatactattagctcattgctgacagtacctgtacttatgaacagtgttcctcctggtgtacaaccataaatttattatttgcttatagtttattctaacctcttgtattcaggaaatttccactggacagttgaagatgttgcaaaatctattgtctgcatgataatgtctggtccatgtcttacaggatacacacaggtttgctgttaggacttggatatgttttatacttttatcgactctcttcataacttcatattatgctgcatggagaactttttgcactgctgctaacaaatatgtcagctttcaaatgttcctgactgtagacaattaacgactggtatgatcgagatatagatgcgataaatgaaccttaccgtcctattccttcaggcgctatatcagaaaatgaggtatgccaatggagctttttcctttcttttctgtgctcatatttattcacagttttgtttagtttcatcagctaatgacaaatgactactctgctgatttatgtgccatcagctatcactttaacattggggaagcacctttagcaatgggtttctgacaaaatactccctccatttttctttataagactaaccaacatcatacagaaaaatagagggggtataccaatataccataagtcgtaaaattgaaaaggttatatatatatatatcatgtaataaactaataatcttattacaagccatatatatttattgatcaactatctacacaatacctcatcgattaaagaagtggtggtgggatggcagacttactgccaccacgactactagttttttttatatatatacactagagattgcgaagtttcgatgcaatccctaatgatgttgccaggtgcaactgtctcaacaatcattgtgtcatgcaaaatgtatctcatgtatttactgacggcaacgatttcatccaggtcattactcaaatttgggcactgttgttagcagggcttggcctgggtgctctgttagatgtatgggtaagtctccagctaactgatcttgaatattagcaggttgaaaaagaaaacgctcttctttgttttcttaattttttttgctacattttgcaggcaggacatgattttcctattattttttatcttgctgttggtgggtccttgctttcttacatatattcagctccacctctgaaggtatttgatacatctgttctgaatcacacaatcccccttgtttttagtacagtacatcataattagtcaacagcttttgattgaaaaaattgaaaaaaaaacacccttgcacatttcagctcaagcagaatggatggattggaaactttgctcttggtgcgagctacattggcttgccctggtaaattaacagtgcggatcttcttccatattgagtaaaaatctatgatattatatgcaagaaattagatgtatatcctatctgtatgtattcttcgcaggtgggctggccaggcattatttggaacccttactcctgatattgttgtcctgacttctttgtatagcatagctggggtatatcttcatacgattacttttcttgtaacagtgtatgcttttcatgatcattgaccgtctttcgtgattttctagctagggattgctattgtaaatgactttaagagtgttgagggagatagagctctggggcttcaggttcttcttctgtctgtagtgtagagttatcacagcccttttctgtagttccaaagaaaagcaatcatccatatcacttaccttttttcagtcactcccggttgcttttggtatggaaactgcaaagtggatatgtgtaggagcgattgacataactcaattatccgttgcaggtaaagacatgcattttcattatgttgcttttgtttcaaacattatcttcaaggctgtatcttggtttcattgattatgtggtccatgttgtcaacttgtcatgctgctatttagcatgccataatgttatgaatttattttattataaggggagggctaaacattaaaggagctaccatgtttgctcagaggcctaaaaattaccatgttattcagagaaaaagagaaatatttgcacggttcgatcatggtgggtctatactctatactgtaacaataaagattgattgctatagatggatgcaaattataattgtatttatagaactagatgcagagttttaagtaagacaatgtaggtctgcacaaccatgcggaaatttgatctggttactatttaaaaatattgtcgtttaaatttccagtgtaatgacgaaagttttaaagaaactataaaagggcagttgctgtgaaacaagaaatgtttcctaaatgttcagaattagctttagaaatgtttcccgtcatcccatgtcagcaaactgtccagcagataaatgttgctatgtcatctttgtgaatttccgtagcaaactgattattctgaggattgctatgttttcgagtggcgaccctagtactttcgaagcaccataaaatattgcattattctgacaaaatgaattccatttttcaggctaccttttcagttccggcaagccttattatgccctggcactgctaggactcacaattcctcaggtggtctttcaggtgagctggtcgttccaattagttctcccaaatggtttcctttatttctctggtctgatcccactcagtacaaaacatttcaaactgctgtgaatattaacatttctccctgtaatgctagtgagtgaaccttttaggttagccatctgcagttcagacaatatcacaatagtatggaattagtgccaccaaactatgtatggcaaaaacatttcttcttacagtccttatgacttaaaaaacaaacaacactgcaaactaaactctggctgccaggaaattcagtcgctctctgctttctactcactctatttcatattataaggcgctctaacttttcctaagcttatagaaaaatatagcaatatttcaacacaaaataaacgtattatcaaaatttatttaatattagatttagtgaaactaatttagtgttatagatatttgtatattttcctatatacttagtcaaacattaaaaaaattaacttagaaaaaattcataacttaggaaaaagtcaaagtatggttgtaatatgaaatggagggagtagcttctaatcctcctcattttccttggagcagttccaatacttcctcaaggaccctgtgaagtatgacgtcaaataccaggtgcgcttctgttagcttcttcaattcattcatctcttccttccccattctgaaactgccaagcagtagaaactggagacaaccaacgcacagtcatctgatcagtgcaatcttacatttgccaaatgcaggcaagcgcgcaaccgttcttcgtcttgggccttctggtgaccgcccttgcaaccagccactgatgaaagcagcaatcgccctggactgtgattctgtgacagcgaagttttgggtggaagatgcagattgatggttctctgcaactgttggtggagctaggttcagcagctatgttcgcgagtgtattagcgctcttttggcggtgctgggtagtagaatgtagaatcgtttcttgttgattccctgaactgatccagatcaaacatcttctaaaggttctgcgatgcaatgctagctgcagacgggagatggtacagggggtcgttttgctactttgccgccgatgttgtagggtgtgtagacagactgtagatgaataatgtcagtaacacctgtggggggttcagtgctagtgggctgcaaaacttgagcactgcttcgatcaaattgtgtctttgattatgaaattatggaatccagcacaggcaggtaataatttcgtaatagagcataaacaatttgtg</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0349700, RefSeq:Os05g0349700