Difference between revisions of "Os07g0214100"
Wangyitong (talk | contribs) (→Function) |
Wangyitong (talk | contribs) (→Function) |
||
| Line 5: | Line 5: | ||
Please input function information here. | Please input function information here. | ||
Seed allergenic protein | Seed allergenic protein | ||
| + | Genomic and two novel cDNA clones for rice seed allergenic protein (RA) belonging to the a-amylase/ | ||
| + | trypsin inhibitor family were isolated and their nucleotide sequences determined. Ten cysteine residues | ||
| + | deduced from nucleotide sequences were completely conserved among three cDNA clones including a | ||
| + | clone, RA17, reported previously. One genomic clone, 24, contained two RA genes, RAG1 and RAG2. | ||
| + | Although RAG1 was cloned at the 5' portion only, two RA genes were arranged divergently. Nucleotide | ||
| + | sequencing and DNA blotting analyses showed that RA are encoded by a multigene family consisting | ||
| + | of at least four members. The transcriptional initiation site of RAG1 was localized at A, 26 bp | ||
| + | upstream of the putative translational initiation codon, ATG, by the primer extension assay. The putative | ||
| + | TATA box and CAAT box existed about 45 bp and 147 bp upstream of the transcription initiation | ||
| + | site, respectively. A conserved sequence (ATGCAAAA) which was similar to the sequence (TGCAAAA) | ||
| + | identified in rice glutelin promoters was observed in the 5' region of the two genes. In addition, | ||
| + | RNA blotting analyses provided that RA genes specifically expressed in ripening seed and their transcripts | ||
| + | accumulated maximally between 15 and 20 days after flowering | ||
===Expression=== | ===Expression=== | ||
Revision as of 02:11, 4 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here.
Seed allergenic protein
Genomic and two novel cDNA clones for rice seed allergenic protein (RA) belonging to the a-amylase/ trypsin inhibitor family were isolated and their nucleotide sequences determined. Ten cysteine residues deduced from nucleotide sequences were completely conserved among three cDNA clones including a clone, RA17, reported previously. One genomic clone, 24, contained two RA genes, RAG1 and RAG2. Although RAG1 was cloned at the 5' portion only, two RA genes were arranged divergently. Nucleotide sequencing and DNA blotting analyses showed that RA are encoded by a multigene family consisting of at least four members. The transcriptional initiation site of RAG1 was localized at A, 26 bp upstream of the putative translational initiation codon, ATG, by the primer extension assay. The putative TATA box and CAAT box existed about 45 bp and 147 bp upstream of the transcription initiation site, respectively. A conserved sequence (ATGCAAAA) which was similar to the sequence (TGCAAAA) identified in rice glutelin promoters was observed in the 5' region of the two genes. In addition, RNA blotting analyses provided that RA genes specifically expressed in ripening seed and their transcripts accumulated maximally between 15 and 20 days after flowering
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os07g0214100 |
|---|---|
| Description |
Seed allergenic protein RA17 precursor |
| Version |
NM_001065719.1 GI:115471170 GeneID:4342722 |
| Length |
640 bp |
| Definition |
Oryza sativa Japonica Group Os07g0214100, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 7:6287055..6287694 |
| Sequence Coding Region |
6287180..6287671 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008400:6287055..6287694 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008400:6287055..6287694 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcttccaacaaggtagtgttctcggtattgctcctcgtcgttctctccgtgctcgcggcggcgatggcgaccatggcggaccaccaccaagtctacagccccggtgagcaatgtcggccaggaataagctatccgacatactcactcccgcaatgtcgaacattggtgaggcgccaatgcgttggccgtggcgcggccagcgccgcggacgagcaagtctggcaagactgctgccggcagctcgccgccgtcgacgacggctggtgcaggtgcggggcgctcgatcacatgctgtcaggcatctacagggagctcggcgccaccgaggccgggcaccccatggccgaggtgttccccggctgccggagaggggacttggagcgcgcggcggcgagcctcccggcgttctgcaacgtggacatccccaatgggcctggtggtgtctgctactggcttgggtatcctaggaccccaagaaccggtcactag</cdnaseq> |
| Protein Sequence |
<aaseq>MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGIS YPTYSLPQCRTLVRRQCVGRGAASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGI YRELGATEAGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGPGGVCYWLGYPRTPR TGH</aaseq> |
| Gene Sequence |
<dnaseqindica>24..515#atttttcacaaactaagcaaaatatggcttccaacaaggtagtgttctcggtattgctcctcgtcgttctctccgtgctcgcggcggcgatggcgaccatggcggaccaccaccaagtctacagccccggtgagcaatgtcggccaggaataagctatccgacatactcactcccgcaatgtcgaacattggtgaggcgccaatgcgttggccgtggcgcggccagcgccgcggacgagcaagtctggcaagactgctgccggcagctcgccgccgtcgacgacggctggtgcaggtgcggggcgctcgatcacatgctgtcaggcatctacagggagctcggcgccaccgaggccgggcaccccatggccgaggtgttccccggctgccggagaggggacttggagcgcgcggcggcgagcctcccggcgttctgcaacgtggacatccccaatgggcctggtggtgtctgctactggcttgggtatcctaggaccccaagaaccggtcactaggctactatagttagctgtgtgtgtgtgactatgtggggttgctaaataattagtgctttcttttgtcaggaagcatctatttatatatatgtggtgaataaatgatgaacttcaatgttcttctg</dnaseqindica> |
| External Link(s) |
