Difference between revisions of "Os11g0104300"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Phenotype)
Line 7: Line 7:
  
 
===Phenotype===
 
===Phenotype===
The rice (Oryza sativa) d53 mutant, which displays reduced height and increased tillering, as well as thinner stem and shorter crown root compared to wild-type plants, is caused by a gain-of-function mutation and is insensitive to exogenous SL treatment. Further, measurement of SLs produced in the root exudates showed that d53 accumulated markedly higher levels of 2′-epi-5-deoxystrigol (epi-5DS), a native SL of rice, than the wild-type cultivar Norin 8.<ref name="ref1" />
+
The rice (Oryza sativa) d53 mutant, which displays reduced height and increased tillering, as well as thinner stem and shorter crown root compared to wild-type plants, is caused by a gain-of-function mutation and is insensitive to exogenous SL treatment. Further, measurement of SLs produced in the root exudates showed that d53 accumulated markedly higher levels of 2′-epi-5-deoxystrigol (epi-5DS), a native SL of rice, than the wild-type cultivar Norin 8.<ref name="ref1" />[[Media:Example.ogg]]
 
 
 
[[File:phenotype of d53 mutant.jpg]]
 
[[File:phenotype of d53 mutant.jpg]]
 
  
 
===Characterization===
 
===Characterization===

Revision as of 08:30, 4 June 2014

DWARF 53(Os11g0104300) acts as a repressor of strigolactone signalling in rice.[1]

Annotated Information

Name

DWARF53D53)


Phenotype

The rice (Oryza sativa) d53 mutant, which displays reduced height and increased tillering, as well as thinner stem and shorter crown root compared to wild-type plants, is caused by a gain-of-function mutation and is insensitive to exogenous SL treatment. Further, measurement of SLs produced in the root exudates showed that d53 accumulated markedly higher levels of 2′-epi-5-deoxystrigol (epi-5DS), a native SL of rice, than the wild-type cultivar Norin 8.[2]Media:Example.ogg Phenotype of d53 mutant.jpg

Characterization

D53 was mapped to the terminal region of the short arm of rice chromosome 11. A single-nucleotide substitution and 15-nucleotide deletion in the third exon of LOC_Os11g01330 in d53, which resulted in an amino acid substitution (R812T) and deletion of five amino acids (813GKTGI817).[2]

Characterization of D53.jpg


Function

DWARF53D53) encodes a substrate of the SCF-D3 ubiquitination complex and functions as a repressor of SL signalling, whose hormone-induced degradation represents a key molecular link between SL perception and responses. D53 can interact with transcriptional co-repressors known as TOPLESS-RELATED PROTEINS.[2] In the absence of SLs, D53 is stable and may recruit TPL/TPR proteins and repress downstream responses. In the presence of SLs, perception of SL leads to SCFD3-mediated ubiquitination of D53 and its subsequent degradation by the proteasome system, which in turn releases the repression of downstream responses.[1]

A proposed model of D53 action.jpg

Expression

The D53 gene product shares predicted features with the class I Clp ATPase proteins and can form a complex with thea/bhydrolase protein DWARF 14 (D14) and the F-box protein DWARF 3 (D3), two previously identified signalling components potentially responsible for SL perception. In a D14- and D3-dependent manner, SLs induce D53 degradation by the proteasome and abrogate its activity in promoting axillary bud outgrowth.[2]

Labs working on this gene

  • National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University, Nanjing 210095, China
  • National Key Facility for Crop Gene Resources and Genetic Improvement, Institute of Crop Science, Chinese Academy of Agricultural Sciences, Beijing 100081, China
  • Department of Pharmacology, University of Washington, Seattle, Washington 98195, USA
  • Howard Hughes Medical Institute, Box 357280, University of Washington, Seattle, Washington 98195, USA
  • National Centre for Plant Gene Research (Beijing), Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, 1-2 Beichen West Road, Beijing 100101, China
  • Department of Applied Biological Chemistry, The University of Tokyo, 1-1-1 Yayoi, Bunkyo, Tokyo 113-8657, Japan

References

  1. 1.0 1.1 Liang Jiang, Xue Liu, Guosheng Xiong, Huihui Liu, Fulu Chen, Lei Wang, Xiangbing Meng, Guifu Liu, Hong Yu, Yundong Yuan, Wei Yi, Lihua Zhao, Honglei Ma, Yuanzheng He, Zhongshan Wu, Karsten Melcher, Qian Qian, H. Eric Xu, Yonghong Wang & Jiayang Li[J]. Nature, 2013, 504,:401–405.
  2. 2.0 2.1 2.2 2.3 Feng Zhou, Qibing Lin, Lihong Zhu, Yulong Ren, Kunneng Zhou, Nitzan Shabek, Fuqing Wu, Haibin Mao, Wei Dong, Lu Gan, Weiwei Ma, He Gao, Jun Chen, Chao Yang, Dan Wang, Junjie Tan, Xin Zhang, Xiuping Guo, Jiulin Wang, Ling Jiang, Xi Liu, Weiqi Chen, Jinfang Chu, Cunyu Yan, Kotomi Ueno etal.D14–SCFD3-dependent degradation of D53 regulates strigolactone signalling[J]. Nature, 2013, 504:406–410.

Structured Information

Gene Name

Os11g0104300

Description

Clp, N terminal domain containing protein

Version

NM_001072059.2 GI:297611030 GeneID:4349543

Length

5140 bp

Definition

Oryza sativa Japonica Group Os11g0104300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 11

Location

Chromosome 11:193178..198317

Sequence Coding Region

193383..194690

Expression

GEO Profiles:Os11g0104300

Genome Context

<gbrowseImage1> name=NC_008404:193178..198317 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008404:193178..198317 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcccactccggtggccgccgcgaggcagtgcctctcgccggccgccgtccccgccctcgacgccgccgtcgcctcctctcgccgccgcgcccacgcccagactacctccctccacctcatctcctccctcctcgccccgcccgcacctcccctcctccgcgacgccctcgcccgcgcccgcagcgccgcctactcaccccgcgtccagctcaaggccctcgacctctgcttcgccgtctccctcgacaggctcccctccgtctccgcatcctcctcctcctctggcgccgccgacgagccccccgtctccaactccctcatggccgccatcaagcgctcccaggccaaccagcgccgcaacccggacaccttccacttctatcaccaggccgccaccgcccagactcccgccgccgtcaaggtcgagctctcccacctcgtcctcgccatcctcgatgaccccgtcgtcagccgcgtcttcgccgaggccggattccgcagcggggacatcaagctcgccatcctccgcccggctccgcccatgccgctcctcggccgcctccccacgcgcacccgtccgccgcctctcttcctctgcagcttcgccgccgcggacgacgccgacgtcccttcgccggccgggaatctcgccggcgcgggggaggagaactgccgccgcatcgcggagatcctctcccgcggccgcaaccccatgctcgtcggcgtcggggccgcctccgccgccgacgacttcgcggccgcctccccgtatcgtatcatccatgtcgaccccaacaccatcgaccgctcagacctcggcgtggcggcggcaatggccagtgccacctccggcctcatcataagcatcggagacctcaagcagctggtccccgatgaggacgcggaggcgcaggagaaggggcggcgggtggtggcggaggtgacgcgagtgctggagacgcacagcaaggtcggccgcgtctgggtgatggggtggtcggcaacgtacgagacctacctcgccttcctctccaaattccccttggtcgacaaggattgggacctccagctgctgccaatcaccgcggtgcatgccgccgccaccgctggccctgctgctgctgctgctggactcatgcctccggcaaccactgttgctgccttctccaagccagctgcaaggtcaagccttttctcttctcttctcttcacttttgtatccatgaattctttatgcataagattttattaccatccatttgctgactgccgtgctttctttattgtcagaatgtttcttggatag</cdnaseq>

Protein Sequence

<aaseq>MPTPVAAARQCLSPAAVPALDAAVASSRRRAHAQTTSLHLISSL LAPPAPPLLRDALARARSAAYSPRVQLKALDLCFAVSLDRLPSVSASSSSSGAADEPP VSNSLMAAIKRSQANQRRNPDTFHFYHQAATAQTPAAVKVELSHLVLAILDDPVVSRV FAEAGFRSGDIKLAILRPAPPMPLLGRLPTRTRPPPLFLCSFAAADDADVPSPAGNLA GAGEENCRRIAEILSRGRNPMLVGVGAASAADDFAAASPYRIIHVDPNTIDRSDLGVA AAMASATSGLIISIGDLKQLVPDEDAEAQEKGRRVVAEVTRVLETHSKVGRVWVMGWS ATYETYLAFLSKFPLVDKDWDLQLLPITAVHAAATAGPAAAAAGLMPPATTVAAFSKP AARSSLFSSLLFTFVSMNSLCIRFYYHPFADCRAFFIVRMFLG</aaseq>

Gene Sequence

<dnaseqindica>206..1513#tcaattccttccttctttccatttattttcttttattttcccaagagaaagagggtgaggaggctccatccgcgaaaagctactcgaccaacccacctgccaccctgcactttccgttattctcatttcaaccctcgcattttttacactccgctccccatgccctgtgaaaactaattacaatccagtccttcaccggtcagcgatgcccactccggtggccgccgcgaggcagtgcctctcgccggccgccgtccccgccctcgacgccgccgtcgcctcctctcgccgccgcgcccacgcccagactacctccctccacctcatctcctccctcctcgccccgcccgcacctcccctcctccgcgacgccctcgcccgcgcccgcagcgccgcctactcaccccgcgtccagctcaaggccctcgacctctgcttcgccgtctccctcgacaggctcccctccgtctccgcatcctcctcctcctctggcgccgccgacgagccccccgtctccaactccctcatggccgccatcaagcgctcccaggccaaccagcgccgcaacccggacaccttccacttctatcaccaggccgccaccgcccagactcccgccgccgtcaaggtcgagctctcccacctcgtcctcgccatcctcgatgaccccgtcgtcagccgcgtcttcgccgaggccggattccgcagcggggacatcaagctcgccatcctccgcccggctccgcccatgccgctcctcggccgcctccccacgcgcacccgtccgccgcctctcttcctctgcagcttcgccgccgcggacgacgccgacgtcccttcgccggccgggaatctcgccggcgcgggggaggagaactgccgccgcatcgcggagatcctctcccgcggccgcaaccccatgctcgtcggcgtcggggccgcctccgccgccgacgacttcgcggccgcctccccgtatcgtatcatccatgtcgaccccaacaccatcgaccgctcagacctcggcgtggcggcggcaatggccagtgccacctccggcctcatcataagcatcggagacctcaagcagctggtccccgatgaggacgcggaggcgcaggagaaggggcggcgggtggtggcggaggtgacgcgagtgctggagacgcacagcaaggtcggccgcgtctgggtgatggggtggtcggcaacgtacgagacctacctcgccttcctctccaaattccccttggtcgacaaggattgggacctccagctgctgccaatcaccgcggtgcatgccgccgccaccgctggccctgctgctgctgctgctggactcatgcctccggcaaccactgttgctgccttctccaagccagctgcaaggtcaagccttttctcttctcttctcttcacttttgtatccatgaattctttatgcataagattttattaccatccatttgctgactgccgtgctttctttattgtcagaatgtttcttggatagtagtgtatctgattaggtgtgctagtacgatttgcttatgttctttactaatttcattttttttaagtgttgatttgtgtgctttgcccattgtatggatatttttttcaacttgtgcaattgatttagtgtactactgtaattagaagcagcataggttgttaaaaaggcataaatctagaaaggtttgttttcttccactgcattttttttaaaaatgtttttacacggtcaatgatgtacaaccgtttttgtttaatgcgatggttgagttatgttctaagtgccatgttactcctgttatgttcttgttgagttatgaccgattcagttctgttaagtacgacaggagttgctggaaattttctcttctcagaagtgggttcctaatgtgttgtcatcagaaccttccagaccaacttccttctagatgctctgctgttagtcactacctgtgttatttactgatttctcagctcttttttcttttttgcctttaggatatttaatgggattttcttcttataagccttttctctgtagtcctattcttgtaatatttttggattttattactacatatgtgtggccatgaaggagaggttctattgccggtgcagaatccatatgcatacacattttgaactgcttgataaagagagactaaagtgtaaaagtaaaataatacagcttgtgtactaagagatgcaatttcatggtaaaagagtggtgcttctgctgcagcacatctgttctttactgctgtaatgctcaaattgctgatagtttgggtcatatatgtgggcagagattatttgtcattaatatgtagtatcacctatagtgaattaccttgatgcatagggctagtgatttctgtcacaacatagtattgtatggcattttattcagctgtagaaatgttaatgcttaagcgttgctggtattaatgacaaagtgacatatacataactccaatataaagcaacgatatgcttgtgtcttgacctcatagtttcaaacttgttattgcagcttgatggactcctttgttccttttggaggctttctctgtgataactacgaagagaacagcctgacagcaaattcatgcccacaggccctgcggtgccagcagtgcaatgataaatatgagcaagaagttgcaactatcattagcgcaagtggcattacagctgaagaccatcaccagggaggtcttccttccctgctgcagaatggcagcatgatgggtcctaacaatggatttgatccagtcaaggtgtgaagctacctatgtcttttggaacatttatgttaagtactgaacgcagcaagcactgcttgttgatagatgaataatttttggtcgttggtataaaagatgcacagttttttttcagtgcaggctagagatgatcggatggtattgaattcaaaaatattgaatctacggaagaagtggaatgagtactgcctgcggctccaccaagaccaccagaggatcaacagagatccttacaaaccatttccgcgctatattggtgttcccactgacaaagaaagatcagcaaattcaagcaaaggttctgagtcagttggggttcaaaaggatgttattaaaccttgtgcggtgtctgctgtacattccagctcaactgcaaggcctatttcatctccatctgtcaccaacaaaagaaatgaagatcttgtattgaaccttcaagccaggcattccaagagtgatgaaaaccttcaagaaaggggcatgcaatcccaacatggcaccctgtcgaatgttgacaatccggatgatcatgtctcaccatcatctgctgcacctgtggaaactgacttggttttgggcacccctcgagagtgtagttcgaaaggttcaagttccacctgcagtaaacgtgtagaggattcagagaggtctgtccatctggtacccaagaaggtggatgatttaaatctgaagcatccacaactctctgttcaacctaattcctgctcctggagttccataaatgttgggaaaacatcacacagtacactacactcagtagcttcaggaggcttctctgcctttggccaatggcagaaacggtcacctcttgctgcacaaaattctgatctgagcaattacaagctacttgttgaacgcctgttcaaggtagttggaaggcaggaggaagccttgagtgctatttgtgaatccattgtgcggtgccggtcaacagagtcgcgccgtggtcctaacaggaatgacatctggttgtgttttcatggttctgacagcatggccaagaagagaatcgccgtggcacttgcagagctcatgcacggcagcaaagataacttgatttatctggacctaaaccttcaggattgggatgactccagtttcagagggaagactggcatagactgcattgtggagcagttgagcaagaaacggcaatctgttctcttccttgacaacattgatagagctgactgccttgttcaggatagtctatctgatgctattaagtctggcaggttccaagacatgcgaggcaaggtggttgacattaatgactcgattgtggttttgtcaagaagcatgatacagggcagcaaaaatgggttggaagagggcctttcattttctgaagaaaagattctggcaactcgcggacatcgactgaagatcctggttgaaccgggtagggcaatcaccagtggatgccctagtggtaaggtggtagtttccccaaggcattttctcaccaaaattcaagcatctttgtgctctggttccatcagcaagagaaagctcagtatttctgatgatcaggaaaagctacaagagtcgccaagcagttcaaagcgactgcacagaacatcgagtgtaccattcgacctgaacctccctgttgatgaagatgaaccccttgatgctgatgacgacagtagtagccatgaaaattcatatggcaacacagaaaaatccattgatgcccttttgcattcggttgatggatcaatcaactttaagccgtttgactttgataaacttgctgatgacatgctgcaggagttcagcaacatactcaggaaaaatctgggttctgagtgcatgttggagattgatgttggtgcaatggaacaaatacttgccgcagcatggaaatcagaggaggataggaaacctgtgccgacctggctggagcaggtttttgccaggagccttgacgagctgaagctcaagcgtaagcatgtgagtagctctacccttagactagtggcctgtgaggacacagtaccagcagtgaaaggagacggtttaggagttttgctcccgccaagaataattctagattgttgatgatattatctgtatagggatcgctgtaattatctgtagtccacaatagtatagcattatttgttggctaaataagctctagtctagctgatgcattgccttgggttctctaattagctactgccattactgtcatatcattttctacctcagggccttttccagatatatgggcatccgaatgtatattggttgtaactactatggattgtcaatatttgattgttctatatatacatggacacatggtgctc</dnaseqindica>

External Link(s)

NCBI Gene:Os11g0104300, RefSeq:Os11g0104300