Difference between revisions of "Os02g0232100"

From RiceWiki
Jump to: navigation, search
(Function)
(Annotated Information)
Line 2: Line 2:
  
 
==Annotated Information==
 
==Annotated Information==
 +
HEI10 exerts its effects in the recombination process through modification of diverse meiotic components during rice meiosis.
 
===Function===
 
===Function===
 
Human Enhancer of Invasion 10 (HEI10; also known asCCNB1IP1) was first isolated from humans and it was demonstrated that the molecule played a role in the mitotic cell cycle <ref name="ref1" />. HEI10 functions as an E3 Ubiquitin ligase to regulate cell migration and invasion <ref name="ref1" /><ref name="ref2" />. Further studies in mice revealed that mutation of HEI10 led to dramatic meiosis defects, indicating an important role of HEI10 during meiosis. It was shown in mice that mutation of HEI10 resulted in high prevalence of univalent chromosomes during metaphase I, which finally leads to a sterile phenotype. Furthermore, results obtained in experiments using a yeast two-hybrid system suggest a function for HEI10 as E3 SUMO ligase in addition to the ubiquitin ligase role reported in somatic cells<ref name="ref2" />.It is further known that HEI10 is required for meiotic CO formation. Consistent with this, it suggests that the role of HEI10 in rice might be the homolog of budding yeast Zip3 and C. elegans ZHP-3. Those genes may play both conserved and divergent roles in homologous recombination in their respective species. It suggests that also in rice HEI10 is essential for reciprocal recombination between homologous chromosomes<ref name="ref3" />.
 
Human Enhancer of Invasion 10 (HEI10; also known asCCNB1IP1) was first isolated from humans and it was demonstrated that the molecule played a role in the mitotic cell cycle <ref name="ref1" />. HEI10 functions as an E3 Ubiquitin ligase to regulate cell migration and invasion <ref name="ref1" /><ref name="ref2" />. Further studies in mice revealed that mutation of HEI10 led to dramatic meiosis defects, indicating an important role of HEI10 during meiosis. It was shown in mice that mutation of HEI10 resulted in high prevalence of univalent chromosomes during metaphase I, which finally leads to a sterile phenotype. Furthermore, results obtained in experiments using a yeast two-hybrid system suggest a function for HEI10 as E3 SUMO ligase in addition to the ubiquitin ligase role reported in somatic cells<ref name="ref2" />.It is further known that HEI10 is required for meiotic CO formation. Consistent with this, it suggests that the role of HEI10 in rice might be the homolog of budding yeast Zip3 and C. elegans ZHP-3. Those genes may play both conserved and divergent roles in homologous recombination in their respective species. It suggests that also in rice HEI10 is essential for reciprocal recombination between homologous chromosomes<ref name="ref3" />.

Revision as of 08:47, 4 June 2014

Please input one-sentence summary here.

Annotated Information

HEI10 exerts its effects in the recombination process through modification of diverse meiotic components during rice meiosis.

Function

Human Enhancer of Invasion 10 (HEI10; also known asCCNB1IP1) was first isolated from humans and it was demonstrated that the molecule played a role in the mitotic cell cycle [1]. HEI10 functions as an E3 Ubiquitin ligase to regulate cell migration and invasion [1][2]. Further studies in mice revealed that mutation of HEI10 led to dramatic meiosis defects, indicating an important role of HEI10 during meiosis. It was shown in mice that mutation of HEI10 resulted in high prevalence of univalent chromosomes during metaphase I, which finally leads to a sterile phenotype. Furthermore, results obtained in experiments using a yeast two-hybrid system suggest a function for HEI10 as E3 SUMO ligase in addition to the ubiquitin ligase role reported in somatic cells[2].It is further known that HEI10 is required for meiotic CO formation. Consistent with this, it suggests that the role of HEI10 in rice might be the homolog of budding yeast Zip3 and C. elegans ZHP-3. Those genes may play both conserved and divergent roles in homologous recombination in their respective species. It suggests that also in rice HEI10 is essential for reciprocal recombination between homologous chromosomes[3].

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0232100

Description

Zinc finger, RING-type domain containing protein

Version

NM_001052906.1 GI:115445182 GeneID:4328810

Length

3452 bp

Definition

Oryza sativa Japonica Group Os02g0232100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:7496475..7499926

Sequence Coding Region

7496552..7496823,7497026..7497189,7497285..7497540,7497756..7497786,7497862..7497907
,7498216..7498288,7498408..7498477

Expression

GEO Profiles:Os02g0232100

Genome Context

<gbrowseImage1> name=NC_008395:7496475..7499926 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:7496475..7499926 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgaagtgcaatgcttgctggcgggagttggaagggcaagctgtatcaacaacctgcggtcatcttttatgtacagaggatgctaagaaaatactgagcaatgatgctgcatgcccgatttgtgatcaagtgctttcaaaaagccatatgagacctgttgatacaaatccaaatgatgattggacaaatatgtcaatggctggagtttctccacagatacttatgaagagtgcatacagaagtgtcatgttttacattgggcaaaaggaactggagatgcagtacaagatgaacagaattgttggtcagtgtaggcaaaagtgtgaacttatgcaggcaaagttcactgagaagctggaagaagttcatactgcataccagaaaatggccaaaaaatgccagttgatggaacaagaggttgaaaacttgtcgagggataagcaagagctacaagaaaaatttgctgagaaatccaggcagaaaaggaagcttgatgagatgtatgatcagctgagaagcgagtatgagtcggcaaagcgttcagcaattcaacctgcgaacaactacttcccaagagcccagccagacctgttctcaggcgtgcccaacataatggatagcagcgaccctctgagacaaggattggctggtcttcctgaaactccagggcggagagatgagggatgggctccaccaccaaggcaacgtcggtccacctctggaccatttgagctgtctgcgggatctcctgctcacaatgcggcgcctccggttgatattaggcccagacagccagcacggcccgtattcggcactgccatgaataatacttctgcagctctgcgaaatatgataatctcgcctgtgaaacgtcctcagctttcccgaaaccgtccacatatgttcacgtaa</cdnaseq>

Protein Sequence

<aaseq>MKCNACWRELEGQAVSTTCGHLLCTEDAKKILSNDAACPICDQV LSKSHMRPVDTNPNDDWTNMSMAGVSPQILMKSAYRSVMFYIGQKELEMQYKMNRIVG QCRQKCELMQAKFTEKLEEVHTAYQKMAKKCQLMEQEVENLSRDKQELQEKFAEKSRQ KRKLDEMYDQLRSEYESAKRSAIQPANNYFPRAQPDLFSGVPNIMDSSDPLRQGLAGL PETPGRRDEGWAPPPRQRRSTSGPFELSAGSPAHNAAPPVDIRPRQPARPVFGTAMNN TSAALRNMIISPVKRPQLSRNRPHMFT</aaseq>

Gene Sequence

<dnaseqindica>3104..3375#2738..2901#2387..2642#2141..2171#2020..2065#1639..1711#1450..1519#gcaaagcaattttgccattctcccgtttcaaacccgcgctctctctctctctctctctctctccccctccctgccgctgctgccgccaccgccgcggcggcgccccgattcggtgatcccccgctcgcccatctccgccgtgacgtatcggcgacgcggagggagccccccaccccccacctccggatctagggtttcgaggcccaggtggcgttgcgctgcgcccccgctcctccgcctctcctccgccgccgagggttcgcgtgaggtaaccgacgcgcccccgtttggtaatcgcaccggcagatatcgtgggggttcgtttctccgtggcgtgttttggtgatggatccgatctaggtttgttttaggggctattttgacccaaatttcaggtgttttgcggagattgtagtgtttctacctagaaatactgcgattattggtgcgtttggagatgccactggctgtgaaatttcctgtgggaactcgtttccagttcgctggggatttatggaatggttacggttttgcaatattacgggttttgcgaactaaggcttcggtttggtcgctcatgggagcaatatttagtacgattgtcatcgccatttctgcaattccaccagcgattggttgctctgttcgtactcccaatagaaagcttgctccgctgctgatatttaaagtgcttcgttggtggatttcaactgcagatgttgggctctgaaggaaatggtgcaatttcttcgtgcatgatgctcgtatattgtgtctattatgtagtcctgcctgcttcggtggttctagatgctacagctttatctgccattctatttatgctgcattctatgttcagggcatgcgcaaaatattattgaaatgatcatttacttgaagataattggatttatttcattaattgctccgtaagccttgattcataggtagtattatgctttttttactactaagtctgtagaatcccatctctcctgcaatagctcataagaaagtgacatgttgtgcgatgcagaactggttctgaatgcatagtccttagtgcattttgagctaccctttgtcaggactgtagtctctgtaaatagtgggagaattcattggctaaaaagatgacaaaagctagctgcttatcagtattaagtgtcgcaccatttcttttatcatgcgagtagtgcaagtgcctgaagggttatcccatttagctattccaaatggcacatacgaaatatgattatttgttcatttgatccgtgatacttaggtagctatgatctgtctctgctcggtttgtttttctgttcagacatgcagaatacaactgctgtctgtattcagtttatatcttgcaactcataattctatgtttctacctgcaggtttctgcgtattaccagctctgtacttaatttactagtgagaagcaaaatgaagtgcaatgcttgctggcgggagttggaagggcaagctgtatcaacaacctgcggtcatcttttatgtatgcctgcaatcttccttactagttttgcttaaccagtttctcattgtaaactaacattgtctgctgctattgcagtatacataactgatccttgctgatgattatccgttgagcaggtacagaggatgctaagaaaatactgagcaatgatgctgcatgcccgatttgtgatcaagtgctttcaaaaaggtctgttgtttactcttgaagttgtattcattatctcatactacattttctcttctttcctgtaagctatttttgaatgtacatcatgatttgacaattagggatgccaaaagtacctcaaacgcatacatatttatcatctcgatggttattgccatgtcatttcatccgaatgggtgcttaacacatggagtttactttctagcatgctttgaagcttttatacttctttgatgtgttcgagtgaaaatggactccagtggtttactattttgagacagtctaaacattataattttttttctcagccatatgagacctgttgatacaaatccaaatgatgattggacaaatgtaagttcgcttacgattcattgtagataaaagcaatccttctttttctaacagccagtctgctcattggtacagatgtcaatggctggagtttctccacagatacgtatccttattattttctcattgtccgtaagattcttgtgctacttttgttgaaaatcatcactaactgctatatggaatctatggcgtagctagcctcttgtcctgttttattgtcatagtaatgcaaaaatctgaaagatcaaaattgtttatatgattattgtctaaggcttggtgactattcagattttccctaactatgatgctaatcagttatgaagagtgcatacagaagtgtcatgttttacattgggcaaaaggaactggagatgcagtacaagatgaacagaattgttggtcagtgtaggcaaaagtgtgaacttatgcaggcaaagttcactgagaagctggaagaagttcatactgcataccagaaaatggccaaaaaatgccagttgatggaacaagaggttgaaaacttgtcgagggataagcaagagctacaagaaaaatttgctgagaaatccaggtcagtatgtacagtacatttctagtttaattctcatatgaataaacctctgcttcatccaacttatatggagaattgactgctgtcatttccaggcagaaaaggaagcttgatgagatgtatgatcagctgagaagcgagtatgagtcggcaaagcgttcagcaattcaacctgcgaacaactacttcccaagagcccagccagacctgttctcaggcgtgcccaacataatggatagcagcgaccctctgagacaaggtaatttaacatgttatcattcagcttattagttctctcataccatataactcatcctttcctctgtgcacacccttttgttatgcttccaaccagaaaaactgttaactgtaatgcttggattgctagtagccactattaaatatataaaagttaaaatgcttttagccctccacaaaaacagcttattcactggctgcaggattggctggtcttcctgaaactccagggcggagagatgagggatgggctccaccaccaaggcaacgtcggtccacctctggaccatttgagctgtctgcgggatctcctgctcacaatgcggcgcctccggttgatattaggcccagacagccagcacggcccgtattcggcactgccatgaataatacttctgcagctctgcgaaatatgataatctcgcctgtgaaacgtcctcagctttcccgaaaccgtccacatatgttcacgtaatgtcctccttattgctcatgcatgtatttcacatctaaatgaagcagtttgggaatgaaaattgatgtccaacttgc</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0232100, RefSeq:Os02g0232100

  1. 1.0 1.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. 2.0 2.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3