Difference between revisions of "Os04g0524300"
Lianglei086 (talk | contribs) (OsRR3 and OsRR5 are primary cytokinin response genes, functioning as negative regulators of cytokinin signaling.) |
|||
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | OsRR5 belongs to thirtten A-type response regulator (RR) genes in the rice genome. | |
| − | + | The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes. | |
| + | OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous ytokinins. | ||
===Expression=== | ===Expression=== | ||
| − | + | Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower. | |
| + | The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress. | ||
===Evolution=== | ===Evolution=== | ||
Revision as of 12:01, 4 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
OsRR5 belongs to thirtten A-type response regulator (RR) genes in the rice genome. The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes. OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous ytokinins.
Expression
Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower. The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os04g0524300 |
|---|---|
| Description |
Similar to ZmRR2 protein (Response regulator 2) |
| Version |
NM_001059883.1 GI:115459495 GeneID:4336439 |
| Length |
1220 bp |
| Definition |
Oryza sativa Japonica Group Os04g0524300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 4:26625768..26626987 |
| Sequence Coding Region |
26625843..26625963,26626041..26626087,26626190..26626267,26626379..26626449,26626539..26626626 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008397:26625768..26626987 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008397:26625768..26626987 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcgtgacggctgtggacagcgggaagagggcattggagctgctaggctcggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtga</cdnaseq> |
| Protein Sequence |
<aaseq>MATCRSRGVERGGAPHVLAVDDSSVDRAVISGILRSSQFRVTAV DSGKRALELLGSEPNVSMIITDYWMPEMTGYELLKKVKESSRLKEIPVVIMSSENVST RINRCLEEGAEDFLLKPVQPSDVSRLCSRVLR</aaseq> |
| Gene Sequence |
<dnaseqindica>76..196#274..320#423..500#612..682#772..859#acggtcacacacagaattcctaaagccgacttggcttttgctcgcgagtaggactgtaggagagatatcgatctgatggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcggtgagctgctggctctcttgctcctgtaccacatattgtccatcctcgttcttcttcttacgtgtgcatgtgtgtagtgacggctgtggacagcgggaagagggcattggagctgctaggctcggtgagtctccggcatcctctgcctttttgctgttggttacgcaaatgtggaggtgtgttttgcctgcgaggccgtaaacgtttttttttctttggctcgcaggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggtaatccggtgatatcaccaccgttatttgggccaacttccatagtactcctcgtgcatattactactcaccttttctgatttgacaatagaaaatggcatatctttgcaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtttgtgtgcacagtatcggtgcccatatctgcccaaatactatcaagatatactcatcttcttgacacgtttttggttaatttgccaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtgagccgtgcaggcggcggccggtcgggtgggcgtcgtgggcgactgaagcgtccctgcatgcatatgcggcttcagtgttttgggggttggaattaatagcagcagaagcagaagcagtagtagtagtgattagtggtagccaaacgcactgtgcgcttgcagatgttgtggttaatgggctgaatttgcctctccctttctctatttttctcattccgaatgtcatgttctagctgttccctgtgtcgatctagaatgcagtttgtcccatcggtttgtccatcccagttgaaaaacctgttgcaacaaatgtctcaattttatgttcttaacagttcatccgttttactagttatattcat</dnaseqindica> |
| External Link(s) |