Difference between revisions of "Os03g0760200"

From RiceWiki
Jump to: navigation, search
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
This gene also called ''CYP81A6'' gene, encodes a kind of protein named CYP81A6, which belongs to cytochrome P450 monooxygenases family<ref name = "ref1"/>. Cytochrome P450 monooxygenases are NADPH-dependent heme proteins that cast a large and diverse group of isozymers and mediate a wide arrange of oxidative reactions in plants, animals, and microorganisms<ref name = "ref1" />. In plants, cytochrome P450s mediate biosynthesis of lignins, terpenoid, and alkaloids, sterols,fatty acids, and many secondary compounds that act as plant defense agents.
+
This gene also called ''CYP81A6'' gene, encodes a kind of protein named CYP81A6, which belongs to cytochrome P450 monooxygenases family<ref name = "ref1"/>. Cytochrome P450 monooxygenases are NADPH-dependent heme proteins that cast a large and diverse group of isozymers and mediate a wide arrange of oxidative reactions in plants, animals, and microorganisms<ref name = "ref1" />. In plants, cytochrome P450s mediate biosynthesis of lignins, terpenoid, and alkaloids, sterols,fatty acids, and many secondary compounds that act as plant defense agents. The protein coded by this gene confers resistance to two different kinds of  herbicides bentazon and sulfonylurea<ref name = "ref1"/>.
  
 
===Expression===
 
===Expression===

Revision as of 13:18, 4 June 2014

Please input one-sentence summary here.

Annotated Information

Function

This gene also called CYP81A6 gene, encodes a kind of protein named CYP81A6, which belongs to cytochrome P450 monooxygenases family[1]. Cytochrome P450 monooxygenases are NADPH-dependent heme proteins that cast a large and diverse group of isozymers and mediate a wide arrange of oxidative reactions in plants, animals, and microorganisms[1]. In plants, cytochrome P450s mediate biosynthesis of lignins, terpenoid, and alkaloids, sterols,fatty acids, and many secondary compounds that act as plant defense agents. The protein coded by this gene confers resistance to two different kinds of herbicides bentazon and sulfonylurea[1].

Expression

Expression of CYP81A6 in various organs of the rice (from reference [1]).

CYP81A6 gene is transcribed in all organs of rice and is highly expressed in shoots, leaf, leaf sheaths and immature panicles, while it is transcribed at low level in the roots [1].

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

  1. 1.0 1.1 1.2 1.3 1.4 Pan, G., et al. (2006). Map-based cloning of a novel rice cytochrome P450 gene CYP81A6 that confers resistance to two different classes of herbicides. Plant Mol Biol 61(6): 933-943.

Structured Information

Gene Name

Os03g0760200

Description

Cytochrome P450 family protein

Version

NM_001057877.1 GI:115455482 GeneID:4334183

Length

2592 bp

Definition

Oryza sativa Japonica Group Os03g0760200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:32294151..32296742

Sequence Coding Region

32294203..32295126,32295853..32296470

Expression

GEO Profiles:Os03g0760200

Genome Context

<gbrowseImage1> name=NC_008396:32294151..32296742 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:32294151..32296742 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggataacgcctacattattgccattctctctgtagctatcctcttcttgctccactactacctcctcggccgcggcaatggcggggcggcgcggctgccgccgggtccaccggccgtcccgatcctgggacacctccacctcgtcaagaagccgatgcacgccaccatgtcccgcctcgccgagcggtacgggccggtgttctcgctgcgcctcgggtcgcggcgcgccgtggtggtgtcgtcgccggggtgcgccagggagtgcttcaccgagcacgacgtgaccttcgcgaaccggcccaggttcgagtcgcagctgctggtctcgttcaacggcgccgcgctcgccacggcgagctacggcgcgcactggcgcaacctccgccggatcgtcgccgtgcagctgctctccgcgcaccgcgtcggcctcatgtcggggctcatcgccggcgaggtccgcgccatggtgcggaggatgtaccgcgccgcggccgcgtcccccgccggcgccgcgcgcatccagctgaagcggaggctgttcgaggtctccctcagcgtgctcatggagaccatcgcccacaccaaggcgacccgccccgagacggacccggacaccgacatgtccgtggaagcccaggagtttaagcaggtcgtcgacgagatcatcccgcacatcggcgcggccaacctgtgggactacttgccggcgctccggtggttcgacgtgttcggcgtcaggaggaagatcctcgccgctgtaagccggagggacgcgttccttcgccgcctgatcgacgcggagcggcggaggctggacgacggcgacgagggcgagaagaagagcatgatcgccgtgctgctcactctgcagaagacagagccggaggtgtacaccgataacatgatcacagctctaacggcgaacttgttcggagcaggaacagagacaacctcgacgacatcagaatgggcgatgtcgctactgctgaaccaccccgacacactcaagaaagcgcaagccgagatcgacgcatccgtcggcaactctcgcctgatcaccgccgacgacgtgactcgcctcggctacctccagtgcatcgtcagggagacgctccgcctgtaccccgccgcgccgatgctcctcccgcacgagtcctccgccgactgcaaggtcggcggctacaacatcccgcgcgggtcgatgttgctcatcaacgcgtacgccatccaccgtgacccggcggtgtgggaggagccggagaagttcatgccggagaggttcgaggacggcgggtgcgacggcaatctcttgatgccgttcgggatggggaggcggaggtgccccggcgagacgctggcgctgcgcacagtggggttggtgctgggcacgctgatccagtgcttcgactgggagagggtcgacggcgtggaggtcgacatgactgaaggtggcgggctcaccatccccaaggtcgtgccgttggaggccatgtgcaggccgcgcgacgccatgggtggtgttcttcgcgagctcgtctga</cdnaseq>

Protein Sequence

<aaseq>MDNAYIIAILSVAILFLLHYYLLGRGNGGAARLPPGPPAVPILG HLHLVKKPMHATMSRLAERYGPVFSLRLGSRRAVVVSSPGCARECFTEHDVTFANRPR FESQLLVSFNGAALATASYGAHWRNLRRIVAVQLLSAHRVGLMSGLIAGEVRAMVRRM YRAAAASPAGAARIQLKRRLFEVSLSVLMETIAHTKATRPETDPDTDMSVEAQEFKQV VDEIIPHIGAANLWDYLPALRWFDVFGVRRKILAAVSRRDAFLRRLIDAERRRLDDGD EGEKKSMIAVLLTLQKTEPEVYTDNMITALTANLFGAGTETTSTTSEWAMSLLLNHPD TLKKAQAEIDASVGNSRLITADDVTRLGYLQCIVRETLRLYPAAPMLLPHESSADCKV GGYNIPRGSMLLINAYAIHRDPAVWEEPEKFMPERFEDGGCDGNLLMPFGMGRRRCPG ETLALRTVGLVLGTLIQCFDWERVDGVEVDMTEGGGLTIPKVVPLEAMCRPRDAMGGV LRELV</aaseq>

Gene Sequence

<dnaseqindica>53..976#1703..2320#agtgcaccagagtcacagaaacacatcacacattcgtgagctcagcttagccatggataacgcctacattattgccattctctctgtagctatcctcttcttgctccactactacctcctcggccgcggcaatggcggggcggcgcggctgccgccgggtccaccggccgtcccgatcctgggacacctccacctcgtcaagaagccgatgcacgccaccatgtcccgcctcgccgagcggtacgggccggtgttctcgctgcgcctcgggtcgcggcgcgccgtggtggtgtcgtcgccggggtgcgccagggagtgcttcaccgagcacgacgtgaccttcgcgaaccggcccaggttcgagtcgcagctgctggtctcgttcaacggcgccgcgctcgccacggcgagctacggcgcgcactggcgcaacctccgccggatcgtcgccgtgcagctgctctccgcgcaccgcgtcggcctcatgtcggggctcatcgccggcgaggtccgcgccatggtgcggaggatgtaccgcgccgcggccgcgtcccccgccggcgccgcgcgcatccagctgaagcggaggctgttcgaggtctccctcagcgtgctcatggagaccatcgcccacaccaaggcgacccgccccgagacggacccggacaccgacatgtccgtggaagcccaggagtttaagcaggtcgtcgacgagatcatcccgcacatcggcgcggccaacctgtgggactacttgccggcgctccggtggttcgacgtgttcggcgtcaggaggaagatcctcgccgctgtaagccggagggacgcgttccttcgccgcctgatcgacgcggagcggcggaggctggacgacggcgacgagggcgagaagaagagcatgatcgccgtgctgctcactctgcagaagacagagccggaggtgtacaccgataacatgatcacagctctaacggcggtgagttcatcttctgctgttttacctttctgatatctgaattctctcattggtgcgtaattttttttttttggctgtcatcggtatagctttcttaagcactcagtagccttgcaattataaaaagaaaaacaatcagtagctttttacatgctttgagtcagtcagtagcagtgtggcactatcagcattcagcagtattcatgttgtttgctaatcactatcatggtttgagtcagcacaatcagtagcttttgacatggtttgagtcagcagtatcttttctaggaactgaattagttattcatttagtacaacttgtttgtctgtctattgattgctttaaattatttcttctatgcaaccctctaatcctagtatagtactagccttttatatgaagaatcatcaataattttcttctcactttcagtgtagctttacttaatgaatattttgaaagatcgcctagttgccttattataattgtataaaaggaaaacaatcagtagccttttacatggttgagtcagcgagttatcaggagtactattgtttatcatggtagtagcacgatagactattcaacccgggcgattaaaatccttctcccaaatttgtattctttgttttttcctcaaaaattcaccaaactcttggaactattatagttcagttttagacaaaaaaaaaatgaaatcttagttccaccctcttgccgtgcagaacttgttcggagcaggaacagagacaacctcgacgacatcagaatgggcgatgtcgctactgctgaaccaccccgacacactcaagaaagcgcaagccgagatcgacgcatccgtcggcaactctcgcctgatcaccgccgacgacgtgactcgcctcggctacctccagtgcatcgtcagggagacgctccgcctgtaccccgccgcgccgatgctcctcccgcacgagtcctccgccgactgcaaggtcggcggctacaacatcccgcgcgggtcgatgttgctcatcaacgcgtacgccatccaccgtgacccggcggtgtgggaggagccggagaagttcatgccggagaggttcgaggacggcgggtgcgacggcaatctcttgatgccgttcgggatggggaggcggaggtgccccggcgagacgctggcgctgcgcacagtggggttggtgctgggcacgctgatccagtgcttcgactgggagagggtcgacggcgtggaggtcgacatgactgaaggtggcgggctcaccatccccaaggtcgtgccgttggaggccatgtgcaggccgcgcgacgccatgggtggtgttcttcgcgagctcgtctgaatattttttggcggcgtttgcatctccaggacgaactcatgtattgaaagcaccaaaagtaagtagcaaataagcttctcgtgagcatacacataacacatgtgagcttgtaatgtggaataaattacacgtagaggatttggaagagagtgactgcgctagcaatcgctctttgagagttgtgttttacagttttagtgaggaaccaatttgtatgaatgtgcaataatcatgtataaagtataattgtacacgccaggtatttcaatttc</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0760200, RefSeq:Os03g0760200