Difference between revisions of "Os02g0830200"
Lianglei086 (talk | contribs) (→Annotated Information) |
|||
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | OsRR3 belongs to thirtten A-type response regulator (RR) genes in the rice genome[1]. The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes[2]. OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous cytokinins[3]. | |
| − | |||
===Expression=== | ===Expression=== | ||
| − | + | Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower. The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress. | |
| − | |||
===Evolution=== | ===Evolution=== | ||
| − | + | Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site. | |
| − | + | [[File:FIG2.png]] | |
| − | |||
==Labs working on this gene== | ==Labs working on this gene== | ||
Revision as of 13:27, 4 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
OsRR3 belongs to thirtten A-type response regulator (RR) genes in the rice genome[1]. The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes[2]. OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous cytokinins[3].
Expression
Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower. The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress.
Evolution
Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os02g0830200 |
|---|---|
| Description |
Similar to ZmRR2 protein (Response regulator 2) |
| Version |
NM_001055148.1 GI:115450023 GeneID:4331245 |
| Length |
794 bp |
| Definition |
Oryza sativa Japonica Group Os02g0830200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 2:36576414..36577207 |
| Sequence Coding Region |
36576414..36576575,36576665..36576742,36576834..36576880,36577099..36577207 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008395:36576414..36577207 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008395:36576414..36577207 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgtcgacgaagacagtgccggagccggagccgcacgtcctcgccgtggacgacagcatcgtcgaccgtactgtcatctccagactcctgcgcagctccaaatatcgagttacgacggtggatagtggcaagagagcactggaggttctcagcctggatcggaatgtgcatatgatcatcacggattactgcatgccggagatgacagggttcgatctcctcaagagggtcaaggagtcggcggagctgaaggagattccggtggtgctaatgtcgtcggagaattcgccgacgagaatccggcggtgcctggaggagggggctgaagactttttgatcaaaccggttcgcccgtctgatgtgtcgcgcctttgcaaccgcgtcatcatgaaatga</cdnaseq> |
| Protein Sequence |
<aaseq>MSTKTVPEPEPHVLAVDDSIVDRTVISRLLRSSKYRVTTVDSGK RALEVLSLDRNVHMIITDYCMPEMTGFDLLKRVKESAELKEIPVVLMSSENSPTRIRR CLEEGAEDFLIKPVRPSDVSRLCNRVIMK</aaseq> |
| Gene Sequence |
<dnaseqindica>633..794#466..543#328..374#1..109#atgtcgacgaagacagtgccggagccggagccgcacgtcctcgccgtggacgacagcatcgtcgaccgtactgtcatctccagactcctgcgcagctccaaatatcgaggtacaattgcgcgcattttatttctattaactgatcgatatgactactagctagcaaatatatatgtgtcatctgtcatctgtgtagaattgagtttcatgtagaatgaagtcgttgattgctcatttggtctggttggttagtacaatcaagtacatatcaagaacaataagcagtcagtcacctttaattttgtttggttgttgttgtgcatgcagttacgacggtggatagtggcaagagagcactggaggttctcagcctggtatgttctttgatccctatgcctgtggatgtcagtcagttttgaagaattgctagaaatgaatgtaaaattagtttgtgttatgatgcaggatcggaatgtgcatatgatcatcacggattactgcatgccggagatgacagggttcgatctcctcaagagggtcaaggttagcatttcagacagtcactcagctcctctctctgtatctggatgttgtagtagcaactgaagattggattggattgtgcatggcaggagtcggcggagctgaaggagattccggtggtgctaatgtcgtcggagaattcgccgacgagaatccggcggtgcctggaggagggggctgaagactttttgatcaaaccggttcgcccgtctgatgtgtcgcgcctttgcaaccgcgtcatcatgaaatga</dnaseqindica> |
| External Link(s) |
