Difference between revisions of "Os02g0830200"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Evolution)
Line 8: Line 8:
 
===Evolution===
 
===Evolution===
 
Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.
 
Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.
 +
 
[[File:FIG2.png]]
 
[[File:FIG2.png]]
  

Revision as of 13:27, 4 June 2014

Please input one-sentence summary here.

Annotated Information

Function

OsRR3 belongs to thirtten A-type response regulator (RR) genes in the rice genome[1]. The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes[2]. OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous cytokinins[3].

Expression

Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower. The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress.

Evolution

Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.

FIG2.png

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0830200

Description

Similar to ZmRR2 protein (Response regulator 2)

Version

NM_001055148.1 GI:115450023 GeneID:4331245

Length

794 bp

Definition

Oryza sativa Japonica Group Os02g0830200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:36576414..36577207

Sequence Coding Region

36576414..36576575,36576665..36576742,36576834..36576880,36577099..36577207

Expression

GEO Profiles:Os02g0830200

Genome Context

<gbrowseImage1> name=NC_008395:36576414..36577207 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:36576414..36577207 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtcgacgaagacagtgccggagccggagccgcacgtcctcgccgtggacgacagcatcgtcgaccgtactgtcatctccagactcctgcgcagctccaaatatcgagttacgacggtggatagtggcaagagagcactggaggttctcagcctggatcggaatgtgcatatgatcatcacggattactgcatgccggagatgacagggttcgatctcctcaagagggtcaaggagtcggcggagctgaaggagattccggtggtgctaatgtcgtcggagaattcgccgacgagaatccggcggtgcctggaggagggggctgaagactttttgatcaaaccggttcgcccgtctgatgtgtcgcgcctttgcaaccgcgtcatcatgaaatga</cdnaseq>

Protein Sequence

<aaseq>MSTKTVPEPEPHVLAVDDSIVDRTVISRLLRSSKYRVTTVDSGK RALEVLSLDRNVHMIITDYCMPEMTGFDLLKRVKESAELKEIPVVLMSSENSPTRIRR CLEEGAEDFLIKPVRPSDVSRLCNRVIMK</aaseq>

Gene Sequence

<dnaseqindica>633..794#466..543#328..374#1..109#atgtcgacgaagacagtgccggagccggagccgcacgtcctcgccgtggacgacagcatcgtcgaccgtactgtcatctccagactcctgcgcagctccaaatatcgaggtacaattgcgcgcattttatttctattaactgatcgatatgactactagctagcaaatatatatgtgtcatctgtcatctgtgtagaattgagtttcatgtagaatgaagtcgttgattgctcatttggtctggttggttagtacaatcaagtacatatcaagaacaataagcagtcagtcacctttaattttgtttggttgttgttgtgcatgcagttacgacggtggatagtggcaagagagcactggaggttctcagcctggtatgttctttgatccctatgcctgtggatgtcagtcagttttgaagaattgctagaaatgaatgtaaaattagtttgtgttatgatgcaggatcggaatgtgcatatgatcatcacggattactgcatgccggagatgacagggttcgatctcctcaagagggtcaaggttagcatttcagacagtcactcagctcctctctctgtatctggatgttgtagtagcaactgaagattggattggattgtgcatggcaggagtcggcggagctgaaggagattccggtggtgctaatgtcgtcggagaattcgccgacgagaatccggcggtgcctggaggagggggctgaagactttttgatcaaaccggttcgcccgtctgatgtgtcgcgcctttgcaaccgcgtcatcatgaaatga</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0830200, RefSeq:Os02g0830200