Difference between revisions of "Os02g0830200"
Lianglei086 (talk | contribs) (→Labs working on this gene) |
Lianglei086 (talk | contribs) (→Labs working on this gene) |
||
| Line 13: | Line 13: | ||
==Labs working on this gene== | ==Labs working on this gene== | ||
Please input related labs here. | Please input related labs here. | ||
| − | 1.Rice seedlings overexpressing OsRR3 and OsRR5 are less sensitive to cytokinin inhibition of root elongation and lateral root formation[ | + | 1.Rice seedlings overexpressing OsRR3 and OsRR5 are less sensitive to cytokinin inhibition of root elongation and lateral root formation[3]. |
[[File:FIG3.png]] | [[File:FIG3.png]] | ||
| Line 19: | Line 19: | ||
at 23°C. Error bars represent SE (N = 30). D. Seeds were grown on plates supplemented with the specified concentrations of BA control under a 16-h photoperiod at 23°C. The total number of lateral roots was determined at 15 days. Error bars represent SE (N= 30). E.Phenotypes of roots for 16-day-old seedlings of (from left to right) ZH11, pACT1:OsRR3, and pACT1:OsRR5 treated with 0.5 μM BA under a 16-h photoperiod. | at 23°C. Error bars represent SE (N = 30). D. Seeds were grown on plates supplemented with the specified concentrations of BA control under a 16-h photoperiod at 23°C. The total number of lateral roots was determined at 15 days. Error bars represent SE (N= 30). E.Phenotypes of roots for 16-day-old seedlings of (from left to right) ZH11, pACT1:OsRR3, and pACT1:OsRR5 treated with 0.5 μM BA under a 16-h photoperiod. | ||
| − | 2.Callus formation of pACT1:OsRR3 and pACT1:OsRR5 is less sensitive to cytokinin. | + | 2.Callus formation of pACT1:OsRR3 and pACT1:OsRR5 is less sensitive to cytokinin[3]. |
[[File:FIG4.png]] | [[File:FIG4.png]] | ||
Revision as of 13:30, 4 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
OsRR3 belongs to thirtten A-type response regulator (RR) genes in the rice genome[1]. The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes[2]. OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous cytokinins[3].
Expression
Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower. The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress.
Evolution
Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.
Labs working on this gene
Please input related labs here.
1.Rice seedlings overexpressing OsRR3 and OsRR5 are less sensitive to cytokinin inhibition of root elongation and lateral root formation[3].
Analysis of root elongation and lateral root formation during overexpression of OsRR3 and OsRR5 in transgenic rice and ZH11 (CK) in the presence of exogenous hormones. A., B., C.Seeds were grown on plates supplemented with the specified concentrations of BA, 2,4-D, ABA, or DMSO control, under a 16-h photoperiod at 23°C. Error bars represent SE (N = 30). D. Seeds were grown on plates supplemented with the specified concentrations of BA control under a 16-h photoperiod at 23°C. The total number of lateral roots was determined at 15 days. Error bars represent SE (N= 30). E.Phenotypes of roots for 16-day-old seedlings of (from left to right) ZH11, pACT1:OsRR3, and pACT1:OsRR5 treated with 0.5 μM BA under a 16-h photoperiod.
2.Callus formation of pACT1:OsRR3 and pACT1:OsRR5 is less sensitive to cytokinin[3].
With increasing cytokinin:auxin ratios, larger calli were formed and green shoots were longer (Figure 4A). Both pACT1:OsRR3 and pACT1:OsRR5 formed smaller calli and shorter shoots with concentrations of hormones that were able to induce ZH11 calli (Figure 4B and C). The decrease in sensitivity to hormones of pACT1:OsRR3 and pACT1:OsRR5 in callus and shoot formation showed that both OsRR3 and OsRR5 act as negative regulators of the cytokinin-signaling system.
References
Please input cited references here. 1. Yukihiro Ito;Nori Kurata
Identification and characterization of cytokinin-signalling gene families in rice Gene, 2006, 382(1): 57-65
2. Mukesh Jain;Akhilesh K Tyagi;Jitendra P Khurana
Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa) BMC Plant Biology, 2006, 6: 1
3. X. Cheng;H. Jiang;J. Zhang;Y. Qian;S. Zhu;B. Cheng
Overexpression of type-A rice response regulators, OsRR3 and OsRR5, results in lower sensitivity to cytokinins Genetics and Molecular Research, 2010, 9(1): 348-359
Structured Information
| Gene Name |
Os02g0830200 |
|---|---|
| Description |
Similar to ZmRR2 protein (Response regulator 2) |
| Version |
NM_001055148.1 GI:115450023 GeneID:4331245 |
| Length |
794 bp |
| Definition |
Oryza sativa Japonica Group Os02g0830200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 2:36576414..36577207 |
| Sequence Coding Region |
36576414..36576575,36576665..36576742,36576834..36576880,36577099..36577207 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008395:36576414..36577207 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008395:36576414..36577207 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgtcgacgaagacagtgccggagccggagccgcacgtcctcgccgtggacgacagcatcgtcgaccgtactgtcatctccagactcctgcgcagctccaaatatcgagttacgacggtggatagtggcaagagagcactggaggttctcagcctggatcggaatgtgcatatgatcatcacggattactgcatgccggagatgacagggttcgatctcctcaagagggtcaaggagtcggcggagctgaaggagattccggtggtgctaatgtcgtcggagaattcgccgacgagaatccggcggtgcctggaggagggggctgaagactttttgatcaaaccggttcgcccgtctgatgtgtcgcgcctttgcaaccgcgtcatcatgaaatga</cdnaseq> |
| Protein Sequence |
<aaseq>MSTKTVPEPEPHVLAVDDSIVDRTVISRLLRSSKYRVTTVDSGK RALEVLSLDRNVHMIITDYCMPEMTGFDLLKRVKESAELKEIPVVLMSSENSPTRIRR CLEEGAEDFLIKPVRPSDVSRLCNRVIMK</aaseq> |
| Gene Sequence |
<dnaseqindica>633..794#466..543#328..374#1..109#atgtcgacgaagacagtgccggagccggagccgcacgtcctcgccgtggacgacagcatcgtcgaccgtactgtcatctccagactcctgcgcagctccaaatatcgaggtacaattgcgcgcattttatttctattaactgatcgatatgactactagctagcaaatatatatgtgtcatctgtcatctgtgtagaattgagtttcatgtagaatgaagtcgttgattgctcatttggtctggttggttagtacaatcaagtacatatcaagaacaataagcagtcagtcacctttaattttgtttggttgttgttgtgcatgcagttacgacggtggatagtggcaagagagcactggaggttctcagcctggtatgttctttgatccctatgcctgtggatgtcagtcagttttgaagaattgctagaaatgaatgtaaaattagtttgtgttatgatgcaggatcggaatgtgcatatgatcatcacggattactgcatgccggagatgacagggttcgatctcctcaagagggtcaaggttagcatttcagacagtcactcagctcctctctctgtatctggatgttgtagtagcaactgaagattggattggattgtgcatggcaggagtcggcggagctgaaggagattccggtggtgctaatgtcgtcggagaattcgccgacgagaatccggcggtgcctggaggagggggctgaagactttttgatcaaaccggttcgcccgtctgatgtgtcgcgcctttgcaaccgcgtcatcatgaaatga</dnaseqindica> |
| External Link(s) |
