Difference between revisions of "Os03g0760200"

From RiceWiki
Jump to: navigation, search
(→‎Annotated Information)
(→‎Annotated Information)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
 +
 +
----
 +
 
This gene also called ''CYP81A6'' gene, encodes a kind of protein named CYP81A6, which belongs to cytochrome P450 monooxygenases family<ref name = "ref1"/>. Cytochrome P450 monooxygenases are NADPH-dependent heme proteins that cast a large and diverse group of isozymers and mediate a wide arrange of oxidative reactions in plants, animals, and microorganisms<ref name = "ref1" />. In plants, cytochrome P450s mediate biosynthesis of lignins, terpenoid, and alkaloids, sterols,fatty acids, and many secondary compounds that act as plant defense agents. The protein coded by this gene confers resistance to two different kinds of  herbicides bentazon and sulfonylurea<ref name = "ref1"/>.
 
This gene also called ''CYP81A6'' gene, encodes a kind of protein named CYP81A6, which belongs to cytochrome P450 monooxygenases family<ref name = "ref1"/>. Cytochrome P450 monooxygenases are NADPH-dependent heme proteins that cast a large and diverse group of isozymers and mediate a wide arrange of oxidative reactions in plants, animals, and microorganisms<ref name = "ref1" />. In plants, cytochrome P450s mediate biosynthesis of lignins, terpenoid, and alkaloids, sterols,fatty acids, and many secondary compounds that act as plant defense agents. The protein coded by this gene confers resistance to two different kinds of  herbicides bentazon and sulfonylurea<ref name = "ref1"/>.
  
 
===Expression===
 
===Expression===
 +
 +
----
 +
 
[[File:FigureOs03g0760200_1.jpg|right|thumb|300px|'''Figure 1.''' '' Expression of ''CYP81A6'' in various organs of the rice (from reference <ref name="ref1" />).'']]
 
[[File:FigureOs03g0760200_1.jpg|right|thumb|300px|'''Figure 1.''' '' Expression of ''CYP81A6'' in various organs of the rice (from reference <ref name="ref1" />).'']]
 +
[[File:FigureOs03g0760200_2.jpg|right|thumb|150px|'''Figure 2.''' '' Bentazon-sensitivity of two mutants (from reference <ref name="ref1" />).'']]
 
''CYP81A6'' gene is transcribed in all organs of rice and is highly expressed in shoots, leaf, leaf sheaths and immature panicles, while it is transcribed at low level in the roots (Figure 1)<ref name = "ref1"/>.
 
''CYP81A6'' gene is transcribed in all organs of rice and is highly expressed in shoots, leaf, leaf sheaths and immature panicles, while it is transcribed at low level in the roots (Figure 1)<ref name = "ref1"/>.
  
 
===Evolution===
 
===Evolution===
 +
 +
----
 +
 
BLAST searches revealed that the deduced amino acid sequence of CYP81A6 was highly similar to that of the previously reported chortoluron hydroxylase CYP81B1 from Helianthus tuberrosus(45% identity and 63% similarity)<ref name = "ref4"/> and CYP81B2 from Nicotiana tabacum(44% identity and 59% similarity) <ref name = "ref5"/> and isoflavone hydroxylase CYP81E1 from Glycyrrhiza echinata(42% identity and 63% similarity)<ref name = "ref6"/> and CYP81E9 from Medicago truncatula(42% identity and 63% similarity)<ref name="ref7"/> nearly over the entire region.
 
BLAST searches revealed that the deduced amino acid sequence of CYP81A6 was highly similar to that of the previously reported chortoluron hydroxylase CYP81B1 from Helianthus tuberrosus(45% identity and 63% similarity)<ref name = "ref4"/> and CYP81B2 from Nicotiana tabacum(44% identity and 59% similarity) <ref name = "ref5"/> and isoflavone hydroxylase CYP81E1 from Glycyrrhiza echinata(42% identity and 63% similarity)<ref name = "ref6"/> and CYP81E9 from Medicago truncatula(42% identity and 63% similarity)<ref name="ref7"/> nearly over the entire region.
 
===Mutaion===
 
===Mutaion===
−
[[File:FigureOs03g0760200_2.jpg|right|thumb|100px|'''Figure 2.''' '' Bentazon-sensitivity of two mutants (from reference <ref name="ref1" />).'']]
+
----
 +
 
 
Two bentazon-lethal mutants 8077S and Norin8m are obtained from γ-radiated ''indica'' cultivar W6154S<ref name = "ref2"/> and ''japonica'' cultivar Norin8<ref name = "ref3"/> respectively. ''CYP81A6'' from 8977S and Norin8m have a single-base deletion of G at the 2058th nucleotide and a single-base deletion of C at the 507th in its coding sequence respectively<ref name = "ref1"/>. Both 8077S and Norin8m plants started to show symptoms to bentazon at 100 mg/l and the lethal concentration was about 300 mg/l(Figure 2). The threshold concentrations of the bentazon sensitivity for the mutant plants were about 60-fold lower than those for their wild-type controls<ref name = "ref1"/>.
 
Two bentazon-lethal mutants 8077S and Norin8m are obtained from γ-radiated ''indica'' cultivar W6154S<ref name = "ref2"/> and ''japonica'' cultivar Norin8<ref name = "ref3"/> respectively. ''CYP81A6'' from 8977S and Norin8m have a single-base deletion of G at the 2058th nucleotide and a single-base deletion of C at the 507th in its coding sequence respectively<ref name = "ref1"/>. Both 8077S and Norin8m plants started to show symptoms to bentazon at 100 mg/l and the lethal concentration was about 300 mg/l(Figure 2). The threshold concentrations of the bentazon sensitivity for the mutant plants were about 60-fold lower than those for their wild-type controls<ref name = "ref1"/>.
  

Revision as of 14:09, 4 June 2014

Please input one-sentence summary here.

Annotated Information

Function

This gene also called CYP81A6 gene, encodes a kind of protein named CYP81A6, which belongs to cytochrome P450 monooxygenases family[1]. Cytochrome P450 monooxygenases are NADPH-dependent heme proteins that cast a large and diverse group of isozymers and mediate a wide arrange of oxidative reactions in plants, animals, and microorganisms[1]. In plants, cytochrome P450s mediate biosynthesis of lignins, terpenoid, and alkaloids, sterols,fatty acids, and many secondary compounds that act as plant defense agents. The protein coded by this gene confers resistance to two different kinds of herbicides bentazon and sulfonylurea[1].

Expression

Figure 1. Expression of CYP81A6 in various organs of the rice (from reference [1]).
Figure 2. Bentazon-sensitivity of two mutants (from reference [1]).

CYP81A6 gene is transcribed in all organs of rice and is highly expressed in shoots, leaf, leaf sheaths and immature panicles, while it is transcribed at low level in the roots (Figure 1)[1].

Evolution

BLAST searches revealed that the deduced amino acid sequence of CYP81A6 was highly similar to that of the previously reported chortoluron hydroxylase CYP81B1 from Helianthus tuberrosus(45% identity and 63% similarity)[2] and CYP81B2 from Nicotiana tabacum(44% identity and 59% similarity) [3] and isoflavone hydroxylase CYP81E1 from Glycyrrhiza echinata(42% identity and 63% similarity)[4] and CYP81E9 from Medicago truncatula(42% identity and 63% similarity)[5] nearly over the entire region.

Mutaion

Two bentazon-lethal mutants 8077S and Norin8m are obtained from γ-radiated indica cultivar W6154S[6] and japonica cultivar Norin8[7] respectively. CYP81A6 from 8977S and Norin8m have a single-base deletion of G at the 2058th nucleotide and a single-base deletion of C at the 507th in its coding sequence respectively[1]. Both 8077S and Norin8m plants started to show symptoms to bentazon at 100 mg/l and the lethal concentration was about 300 mg/l(Figure 2). The threshold concentrations of the bentazon sensitivity for the mutant plants were about 60-fold lower than those for their wild-type controls[1].

Labs working on this gene

Please input related labs here.

References

  1. ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 Pan, G., et al. (2006). Map-based cloning of a novel rice cytochrome P450 gene CYP81A6 that confers resistance to two different classes of herbicides. Plant Mol Biol 61(6): 933-943.
  2. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref4
  3. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref5
  4. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref6
  5. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref7
  6. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  7. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref3

Structured Information

Gene Name

Os03g0760200

Description

Cytochrome P450 family protein

Version

NM_001057877.1 GI:115455482 GeneID:4334183

Length

2592 bp

Definition

Oryza sativa Japonica Group Os03g0760200, complete gene.

Source

Oryza sativa Japonica Group 

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:32294151..32296742

Sequence Coding Region

32294203..32295126,32295853..32296470

Expression

GEO Profiles:Os03g0760200

Genome Context

<gbrowseImage1> name=NC_008396:32294151..32296742 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:32294151..32296742 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggataacgcctacattattgccattctctctgtagctatcctcttcttgctccactactacctcctcggccgcggcaatggcggggcggcgcggctgccgccgggtccaccggccgtcccgatcctgggacacctccacctcgtcaagaagccgatgcacgccaccatgtcccgcctcgccgagcggtacgggccggtgttctcgctgcgcctcgggtcgcggcgcgccgtggtggtgtcgtcgccggggtgcgccagggagtgcttcaccgagcacgacgtgaccttcgcgaaccggcccaggttcgagtcgcagctgctggtctcgttcaacggcgccgcgctcgccacggcgagctacggcgcgcactggcgcaacctccgccggatcgtcgccgtgcagctgctctccgcgcaccgcgtcggcctcatgtcggggctcatcgccggcgaggtccgcgccatggtgcggaggatgtaccgcgccgcggccgcgtcccccgccggcgccgcgcgcatccagctgaagcggaggctgttcgaggtctccctcagcgtgctcatggagaccatcgcccacaccaaggcgacccgccccgagacggacccggacaccgacatgtccgtggaagcccaggagtttaagcaggtcgtcgacgagatcatcccgcacatcggcgcggccaacctgtgggactacttgccggcgctccggtggttcgacgtgttcggcgtcaggaggaagatcctcgccgctgtaagccggagggacgcgttccttcgccgcctgatcgacgcggagcggcggaggctggacgacggcgacgagggcgagaagaagagcatgatcgccgtgctgctcactctgcagaagacagagccggaggtgtacaccgataacatgatcacagctctaacggcgaacttgttcggagcaggaacagagacaacctcgacgacatcagaatgggcgatgtcgctactgctgaaccaccccgacacactcaagaaagcgcaagccgagatcgacgcatccgtcggcaactctcgcctgatcaccgccgacgacgtgactcgcctcggctacctccagtgcatcgtcagggagacgctccgcctgtaccccgccgcgccgatgctcctcccgcacgagtcctccgccgactgcaaggtcggcggctacaacatcccgcgcgggtcgatgttgctcatcaacgcgtacgccatccaccgtgacccggcggtgtgggaggagccggagaagttcatgccggagaggttcgaggacggcgggtgcgacggcaatctcttgatgccgttcgggatggggaggcggaggtgccccggcgagacgctggcgctgcgcacagtggggttggtgctgggcacgctgatccagtgcttcgactgggagagggtcgacggcgtggaggtcgacatgactgaaggtggcgggctcaccatccccaaggtcgtgccgttggaggccatgtgcaggccgcgcgacgccatgggtggtgttcttcgcgagctcgtctga</cdnaseq>

Protein Sequence

<aaseq>MDNAYIIAILSVAILFLLHYYLLGRGNGGAARLPPGPPAVPILG HLHLVKKPMHATMSRLAERYGPVFSLRLGSRRAVVVSSPGCARECFTEHDVTFANRPR FESQLLVSFNGAALATASYGAHWRNLRRIVAVQLLSAHRVGLMSGLIAGEVRAMVRRM YRAAAASPAGAARIQLKRRLFEVSLSVLMETIAHTKATRPETDPDTDMSVEAQEFKQV VDEIIPHIGAANLWDYLPALRWFDVFGVRRKILAAVSRRDAFLRRLIDAERRRLDDGD EGEKKSMIAVLLTLQKTEPEVYTDNMITALTANLFGAGTETTSTTSEWAMSLLLNHPD TLKKAQAEIDASVGNSRLITADDVTRLGYLQCIVRETLRLYPAAPMLLPHESSADCKV GGYNIPRGSMLLINAYAIHRDPAVWEEPEKFMPERFEDGGCDGNLLMPFGMGRRRCPG ETLALRTVGLVLGTLIQCFDWERVDGVEVDMTEGGGLTIPKVVPLEAMCRPRDAMGGV LRELV</aaseq>

Gene Sequence

<dnaseqindica>53..976#1703..2320#agtgcaccagagtcacagaaacacatcacacattcgtgagctcagcttagccatggataacgcctacattattgccattctctctgtagctatcctcttcttgctccactactacctcctcggccgcggcaatggcggggcggcgcggctgccgccgggtccaccggccgtcccgatcctgggacacctccacctcgtcaagaagccgatgcacgccaccatgtcccgcctcgccgagcggtacgggccggtgttctcgctgcgcctcgggtcgcggcgcgccgtggtggtgtcgtcgccggggtgcgccagggagtgcttcaccgagcacgacgtgaccttcgcgaaccggcccaggttcgagtcgcagctgctggtctcgttcaacggcgccgcgctcgccacggcgagctacggcgcgcactggcgcaacctccgccggatcgtcgccgtgcagctgctctccgcgcaccgcgtcggcctcatgtcggggctcatcgccggcgaggtccgcgccatggtgcggaggatgtaccgcgccgcggccgcgtcccccgccggcgccgcgcgcatccagctgaagcggaggctgttcgaggtctccctcagcgtgctcatggagaccatcgcccacaccaaggcgacccgccccgagacggacccggacaccgacatgtccgtggaagcccaggagtttaagcaggtcgtcgacgagatcatcccgcacatcggcgcggccaacctgtgggactacttgccggcgctccggtggttcgacgtgttcggcgtcaggaggaagatcctcgccgctgtaagccggagggacgcgttccttcgccgcctgatcgacgcggagcggcggaggctggacgacggcgacgagggcgagaagaagagcatgatcgccgtgctgctcactctgcagaagacagagccggaggtgtacaccgataacatgatcacagctctaacggcggtgagttcatcttctgctgttttacctttctgatatctgaattctctcattggtgcgtaattttttttttttggctgtcatcggtatagctttcttaagcactcagtagccttgcaattataaaaagaaaaacaatcagtagctttttacatgctttgagtcagtcagtagcagtgtggcactatcagcattcagcagtattcatgttgtttgctaatcactatcatggtttgagtcagcacaatcagtagcttttgacatggtttgagtcagcagtatcttttctaggaactgaattagttattcatttagtacaacttgtttgtctgtctattgattgctttaaattatttcttctatgcaaccctctaatcctagtatagtactagccttttatatgaagaatcatcaataattttcttctcactttcagtgtagctttacttaatgaatattttgaaagatcgcctagttgccttattataattgtataaaaggaaaacaatcagtagccttttacatggttgagtcagcgagttatcaggagtactattgtttatcatggtagtagcacgatagactattcaacccgggcgattaaaatccttctcccaaatttgtattctttgttttttcctcaaaaattcaccaaactcttggaactattatagttcagttttagacaaaaaaaaaatgaaatcttagttccaccctcttgccgtgcagaacttgttcggagcaggaacagagacaacctcgacgacatcagaatgggcgatgtcgctactgctgaaccaccccgacacactcaagaaagcgcaagccgagatcgacgcatccgtcggcaactctcgcctgatcaccgccgacgacgtgactcgcctcggctacctccagtgcatcgtcagggagacgctccgcctgtaccccgccgcgccgatgctcctcccgcacgagtcctccgccgactgcaaggtcggcggctacaacatcccgcgcgggtcgatgttgctcatcaacgcgtacgccatccaccgtgacccggcggtgtgggaggagccggagaagttcatgccggagaggttcgaggacggcgggtgcgacggcaatctcttgatgccgttcgggatggggaggcggaggtgccccggcgagacgctggcgctgcgcacagtggggttggtgctgggcacgctgatccagtgcttcgactgggagagggtcgacggcgtggaggtcgacatgactgaaggtggcgggctcaccatccccaaggtcgtgccgttggaggccatgtgcaggccgcgcgacgccatgggtggtgttcttcgcgagctcgtctgaatattttttggcggcgtttgcatctccaggacgaactcatgtattgaaagcaccaaaagtaagtagcaaataagcttctcgtgagcatacacataacacatgtgagcttgtaatgtggaataaattacacgtagaggatttggaagagagtgactgcgctagcaatcgctctttgagagttgtgttttacagttttagtgaggaaccaatttgtatgaatgtgcaataatcatgtataaagtataattgtacacgccaggtatttcaatttc</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0760200, RefSeq:Os03g0760200

Retrieved from "https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0760200&oldid=177563"