Difference between revisions of "Os07g0108900"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 6: Line 6:
  
 
'''''OsMADS15''''' is required to ensure sexual reproduction in rice and mutations of it lead to the switch of reproductive habit from sexual to asexual in rice.
 
'''''OsMADS15''''' is required to ensure sexual reproduction in rice and mutations of it lead to the switch of reproductive habit from sexual to asexual in rice.
Phylogenetic analyses have characterized '''''OsMADS15''''' as an APETALA1 (AP1)/FRUITFUL (FUL)-like gene <ref name="ref7" />. In addition, previous study has shown that '''''OsMADS15''''' (RAP1A) RNA was expressed in the incipient floral primordium and later mainly accumulated in empty glumes, lemma, palea and lodicules <ref name="ref8" />.  The effects of '''''OsMADS15''''' on cell specifications of all spikelet whorls were histologically examined. In a severely affected dep spikelet, the transformed palea was actually only composed of two PMTs while the PMS was completely lost . This implied that the identity of palea was lost in the dep spikelet with the severe phenotype. The lemma in the dep spikelet was also slightly affected, but its identity was still maintained . The glumes of dep spikelets contained many more bundles than the WT glumes, suggesting a possible partial reversion of glumes to leaf-like organs. No obvious difference was found in the inner three whorls, hinting that they are not affected by the mutation of '''''OsMADS15'''''. Thus, '''''OsMADS15''''' is required for the specification of PMS and empty glumes.
+
Phylogenetic analyses have characterized '''''OsMADS15''''' as an APETALA1 (AP1)/FRUITFUL (FUL)-like gene <ref name="ref7" />. In addition, previous study has shown that '''''OsMADS15''''' (RAP1A) RNA was expressed in the incipient floral primordium and later mainly accumulated in empty glumes, lemma, palea and lodicules <ref name="ref8" />.  The effects of '''''OsMADS15''''' on cell specifications of all spikelet whorls were histologically examined. In a severely affected dep spikelet, the transformed palea was actually only composed of two PMTs while the PMS was completely lost . This implied that the identity of palea was lost in the dep spikelet with the severe phenotype. The lemma in the dep spikelet was also slightly affected, but its identity was still maintained . The glumes of dep spikelets contained many more bundles than the WT glumes, suggesting a possible partial reversion of glumes to leaf-like organs. No obvious difference was found in the inner three whorls, hinting that they are not affected by the mutation of '''''OsMADS15'''''. Thus, '''''OsMADS15''''' is required for the specification of PMS and empty glumes.[[File:Example23.jpg]]
  
 
===Expression===
 
===Expression===

Revision as of 15:42, 4 June 2014

The rice Os07g0108900 gene is reported as MADS-box transcription factor 15(OsMADS15).

Annotated Information

Function

The rice Os07g0108900 gene is reported as MADS-box transcription factor 15(OsMADS15). Rice OsMADS15 is a member of APETALA1/SQUAMOSA(AP1/SQUA) subfamily, which plays important roles in biological processes such as flowering time regulation, adventitious roots development, stem growth, reproductive development, crown root development and palea development[1]. The OsMADS15 is the ortholog of Arabidopsis AP1 gene. OsMADS15 function in tetramer complexes with OsMADS1, OsMADS8 and OsMADS14, as described in floral quartet model[2]. Rice seedlings overexpressing OsMADS15 showed precocious phenotypes of early internode elongation, shoot-borne crown root development, reduced plant height and early flowering. OsMADS15 interacts with OsMADS1 in yeast two-hybrid experiments[2].

OsMADS15 is required to ensure sexual reproduction in rice and mutations of it lead to the switch of reproductive habit from sexual to asexual in rice. Phylogenetic analyses have characterized OsMADS15 as an APETALA1 (AP1)/FRUITFUL (FUL)-like gene [3]. In addition, previous study has shown that OsMADS15 (RAP1A) RNA was expressed in the incipient floral primordium and later mainly accumulated in empty glumes, lemma, palea and lodicules [4]. The effects of OsMADS15 on cell specifications of all spikelet whorls were histologically examined. In a severely affected dep spikelet, the transformed palea was actually only composed of two PMTs while the PMS was completely lost . This implied that the identity of palea was lost in the dep spikelet with the severe phenotype. The lemma in the dep spikelet was also slightly affected, but its identity was still maintained . The glumes of dep spikelets contained many more bundles than the WT glumes, suggesting a possible partial reversion of glumes to leaf-like organs. No obvious difference was found in the inner three whorls, hinting that they are not affected by the mutation of OsMADS15. Thus, OsMADS15 is required for the specification of PMS and empty glumes.File:Example23.jpg

Expression

OsMADS15 was previously isolated through a large-scale cDNA analysis conducted by the Rice GenomeResearch Program (RGP). It is expressed in the apical region of the floral meristem at an early stage of spikelet development, and also expressed in developing lemma, palea and lodicules[2]. OsMADS15are expressed in the incipient floral primordium[5]. Transcripts of OsMADS1 and OsMADS15 are eventually accumulated in lemma and palea, suggesting that OsMADS1 and OsMADS15 might also be involved in the development of lemma and palea[6]. Rice seedlings overexpressing OsMADS15 showed precocious phenotypes of early internode elongation, shoot-borne crown root development, reduced plant height and early flowering, and Affected Panicle Development and Produced Ectopic Crown Root Growth.

1.Overexpression of OsMADS15 Decreased Tiller Number(Fig. 1).

Pictures.jpg

2.Overexpression of OsMADS15 Accelerated Flowering(Fig. 2).

Fig.2.jpg

RT-PCR with the following primers: OsMADS15-F, 5- TCCGTCGACATGGGGCGGGGGAAGGTG-3; OsMADS15-R, 5- AATGGTACCTTAAGCATTGAGGTGGCTC-3[7].

Mutation

Single amino acid mutation disrupted the transcriptional activation of OsMADS15 in DEP mutant and caused shrunken paleas.DEP mutant was caused by a genetic alteration in OsMADS15. A single nucleotide G to C substitution at position 94 in coding region was found in the first exon of the OsMADS15. This substitution results in a change from a MADS-box conserved alanine residue to proline. Mutations of them lead to the switch of reproductive habit from sexual to asexual in rice. Paleas in severe DEP florets degenerated to glume-like organs that were prone to splitting. The premier used in this mutation experiment[8]: Premier in dep.jpg

Labs working on this gene

College of Agriculture and Biotechnology, Zhejiang University, Hangzhou, China.

References

  1. Lu Sunjie; Wang Huimei, Yang Ruifang, Zhang Xiaobo, Tu Jumin, 2013.Screening of Rice OsMADS15 Interacting Proteins by Yeast Two Hybrid System,Journol of Agricultural Biotechnology.21,127-136.
  2. 2.0 2.1 2.2 Lu, S.J., Wei, H., Wang, Y., Wang, H.M., Yang, R.F., Zhang, X.B. and Tu, J.M., 2012. Overexpression of a Transcription Factor OsMADS15 Modifies Plant Architecture and Flowering Time in Rice (Oryza sativa L.), Plant Molecular Biology Reporter. 30, 1461-1469.
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref7
  4. Cite error: Invalid <ref> tag; no text was provided for refs named ref8
  5. Lim, J., Moon, Y.H., An, G. and Jang, S.K., 2000. Two rice MADS domain proteins interact with OsMADS1, Plant Mol Biol. 44, 513-27.
  6. Kyozuka, J., Kobayashi, T., Morita, M. and Shimamoto, K., 2000. Spatially and temporally regulated expression of rice MADS box genes with similarity to Arabidopsis class A, B and C genes, Plant Cell Physiol. 41, 710-8.
  7. Prasad, K., Sriram, P., Kumar, C.S., Kushalappa, K. and Vijayraghavan, U., 2001. Ectopic expression of rice OsMADS1 reveals a role in specifying the lemma and palea, grass floral organs analogous to sepals, Dev Genes Evol. 211, 281-90.
  8. . Wang, K., Tang, D., Hong, L., Xu, W., Huang, J., Li, M., Gu, M., Xue, Y. and Cheng, Z., 2010. DEP and AFO regulate reproductive habit in rice, PLoS Genet. 6, e1000818.

Structured Information

Gene Name

Os07g0108900

Description

MADS15 protein

Version

NM_001065255.1 GI:115470242 GeneID:4342214

Length

6425 bp

Definition

Oryza sativa Japonica Group Os07g0108900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:470174..476598

Sequence Coding Region

470595..470721,470877..471040,471552..471593,471730..471771,472147..472246
,472396..472460,473795..473873,476290..476474

Expression

GEO Profiles:Os07g0108900

Genome Context

<gbrowseImage1> name=NC_008400:470174..476598 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:470174..476598 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggcgggggaaggtgcagctgaagcggatagagaacaagatcaacaggcaggtgacgttctccaagaggaggaatggattgctgaagaaggcgcacgagatctccgtcctctgcgacgccgaggtcgccgccatcgtcttctcccccaagggcaagctctacgagtacgccactgactccaggatggacaaaatccttgaacgttatgagcgctattcatatgctgaaaaggctcttatttcagctgaatccgagagtgagggaaattggtgccatgaatacaggaaacttaaggcaaagattgagaccatacaaaaatgtcacaaacacctcatgggagaggatctagaatccctgaatctcaaagaactccaacagctagagcagcagctggagagttcattgaagcacataatatcaagaaagagccaccttatgcttgagtccatttccgagctgcagaaaaaggagaggtcactgcaggaggagaacaaggctctgcagaaggaactggtggagaggcagaagaatgtgaggggccagcagcaagtagggcagtgggaccaaacccaggtccaggcccaggcccaagcccaaccccaagcccagacaagctcctcctcctcctccatgctgagggatcagcaggcacttcttccaccacaaaatatctgctacccgccggtgatgatgggcgagagaaatgatgcggcggcggcggcggcggtggcggcgcagggccaggtgcaactccgcatcggaggtcttccgccatggatgctgagccacctcaatgcttaa</cdnaseq>

Protein Sequence

<aaseq>MGRGKVQLKRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVA AIVFSPKGKLYEYATDSRMDKILERYERYSYAEKALISAESESEGNWCHEYRKLKAKI ETIQKCHKHLMGEDLESLNLKELQQLEQQLESSLKHIISRKSHLMLESISELQKKERS LQEENKALQKELVERQKNVRGQQQVGQWDQTQVQAQAQAQPQAQTSSSSSSMLRDQQA LLPPQNICYPPVMMGERNDAAAAAAVAAQGQVQLRIGGLPPWMLSHLNA</aaseq>

Gene Sequence

<dnaseqindica>5878..6004#5559..5722#5006..5047#4828..4869#4353..4452#4139..4203#2726..2804#125..309#ctcctcctcctcttcttcttcttccactagctagttcgtcttcctccttcagctagcttgtagcagctaaggttaggtcggatcgagatcgggatcggccgccggcgagcggcgagcggcgaggatggggcgggggaaggtgcagctgaagcggatagagaacaagatcaacaggcaggtgacgttctccaagaggaggaatggattgctgaagaaggcgcacgagatctccgtcctctgcgacgccgaggtcgccgccatcgtcttctcccccaagggcaagctctacgagtacgccactgactccaggtacacctatagcctgatcgattccttgccatttctggagcacctgagcccgcctgagatggatgaactcaataattctcctagctttttgccgtttctggccggccgcttccatggatttcagctgctgctctctgaatttgccatgtttggtttgtgcatctggttgcatgtgtgctacagctgatgattttatgcttcactagtgctgcaacacatgcaacacagtccaatccaagctagctcagctactccaggaggaggagtcagctgcatgcctcctcatttcgggaaatcatctctctctctttctattttttccctttcctttcttgtttcccctttttctttcctgctagcttgcttctctctctacaccctgcataccctttttgggattgatggccggttttaattaatttcccctcctttctttagttaattactaccctactactaattcatctcctcccgatcctctcaatttctcatcatatggagtactactaaaatatatatatgtagtacgcacttggtgtggccggtctttgttaacatcatgtgcttgcttagattcaaggggattatatatataagaggatctactactaagtgtactttgtgattacatcagctatctatgtagctgatgatcttgctttggtcttttgctgatccattgagctagtgctaattctcatcacccttccatttgatgtactgcaaatagttttttattcattcgcttcttctccctcttccccatgtgatttgattgctagctccttcctgacttttatttgggttgatttcgtcacatcttcctctcaaattaatctcatgcgcgtgcctttgttctccacctgtcaagaaattaattaaagaatatatcacacgaattacgaggagtccaccaccagtgtcatgcactcctccctattgttcacagtcacagctgatgcatgcaaaacatcttctgtttctcaagtaattaattcccctcttcttgtgaggcttggcttaaaattactcaaacagctgtttttcttgcttatgcatcatcttcctcagataccaaaacgttggagatggacagatctggcctttcctcttcccttctctctcatcctcttctatgtttctgcctcttcttatgatgaatctttatttggtattattcacgttaagcatctctttaaagagccctagatcaaatttgatctatctcttttggtttaacttcatggccagttgcttgtgtgttttggtctagaacgaccacgtacgcgagatatttccttttctgctcagctgattaattaataatgatgggataattcactaattattctggagttagatcaagagatgtacttaaacatcctgtgacacgatgacttcaaaaaataatcttgctctctgtaaaatcacataatagctagccatcgcgcgtgtttcagaaaaataatttatcttgcttgctagcttttgctcaaaatgcgtttctgacgtctaggtaaagaggacttttacggtcgtctgtgttgtactggaacagtgccctgcacactccccagcgtcaagatcagtctaaggcgcttcatttctagctcagaaatcttcacttatttgatcttaattatagatcttcctgagatagatctaagggtgttccagtaaaacagaagaagtcaagttcttcaggatcctcgtgatataattaaactgtagtctcacaatcttactgatcatcaaggagtctgtaaacacctatacgtacggctataggattatggggaggttggtctaaaataaaggtgttaaattacttgcaattatcaagatgtgcaaatcatcacccagtaattcaatggtgctattatatatagtctgttttgaacagttccactggttttgttagggtccttgctgatggctgtttaacggtgctgttatatataatcttgattattttttttgctaaattttcctaagcaacccacttcaaattttggaatgggtgaattcttatgttcacaccctcatatcacatgtgtcatgaggagcttttttttcgtcacacagtcccatacaacgtccctgttttcttgaagataagataattcatgcatgcacttgaatataaccgagtgttttcatgtgcatgctttttatttggctgtgtcgagtgtttagacagcaaaagagctcttgtgcatacaaatgccgatatctatatattagtagtcttaatccacatttcagctttaattgcttggaatagtttggtaggcattcctagcttcagaccatttaaatatacttcctaaacgttgtcatgagaatgctgaatgcaaagtatttacatatatagtggactaatttcagattctgctcatgatggttttccctgcaggatggacaaaatccttgaacgttatgagcgctattcatatgctgaaaaggctcttatttcagctgaatccgagagtgaggtaaaacacagtaggttgtatgatatataacttttacatgaagggaatattattgttccttttctattgcattagcatttcaatcatatcatttccttgtggccttttaaatcacatgttaacaaagcagtttttctgaattctatcgttctacttgccaaaactagatgttggtaaccttctgttttatactttttaacttcaaacctcgtgtcttttgcactctggcatatttcttaaaatttctacttattgggatatcatgcaggagagtcctcattcccttcatttaatcccctcaaattttatttattatggtcatacaattaatgggccacatgcatggaagtcgatcgccagcttgcgatcagcatcctatcattaatgttatgatctatactaattcttctgtaaataaattaaaattgcactagtttttaactaaatgctactattctatttttttatccatactccgtttgagtggtttcttttgtgtttcatgaagcaatataatatgcttaagaaaacatagaaacatgcacaatacaataatagcgctggtagaatccggttggagaccaaatgtttcgatattctaagtgcatatttatatatactaagtaaaactgtaatcataaacatgcatatggactgtgatcgatgaaatgtttcttcattttttttttcaagataactcttccccagttgacaacatgcactgcatccagaagtactcatggtatttgttttcagtactgtttgatgagtaaaactttggtaagtgttaaaaaatgatgataagtgcaaatatttgttcctttaccacttccaccttcttggagtaaagaaaaaaatgtgtgtggtttggcaaagttgttgcatatatcacggcattagtgtgcggataatgcgaataaatgcatcaataagcactaggagtaagttaattagttctctaccttaattgaaaagttcatgtacatttaaaaaaattaaacatgcctctttttatcatttgttgaatttctacatttatcaagacagcaaaggagttctcatctactaataaattaatttaaggagctataactcccttaattttatcaaatattcacatacacggttgcatttgaggattttctatatactccactaaatgaggatgcatttaggttctttataatattttatttccatcgtttcatcatctgtttatgtttacagtaatttagtaatagttctctaattttgacagtaatggttggctcacagaaaacatcaaccaaccatatatattggtttatactgacaaagagtttttttttgtacagggaaattggtgccatgaatacaggaaacttaaggcaaagattgagaccatacaaaaatgtcacaagtaatcgatatatatatccaatttctataataatgttaaataaatttcgaactaattgcactaattattatttttaaaccaatttaaaagagaacttccggtattgactgctgaagatgacgtgaaactaacttatgtatcttgtgtagacacctcatgggagaggatctagaatccctgaatctcaaagaactccaacagctagagcagcagctggagagttcattgaagcacataatatcaagaaaggtagtatttttttggatagtggaatctttttatttgaactcccgacctctacacaccaaatgtacagaaaaaaaggagcaaattattaaaagaaacgtagtaatatatttagcatgttctgtttcaaactggactgaattgaaataattcatgcatgcgcatgcctgagttacataaatatatatccaaatgtcttgttgtcactgctactttgaaacaaatgttcttttttttttcctttttgagaaaatatatgagtaaatattttcagcacattctggaggaacaattaccaaatataaactttttagcacattctggagtacaattaccaaatatgacggactaactagaacaatatgtttgtgtttgcagagccaccttatgcttgagtccatttccgagctgcagaaaaaggtgaccaattgaactgcactactgtgtatgcatgtatatatgaatcgtgcatgcaaaccgttgttagctagtagttagttatagtttactcttggttagtctcaactgatagtgcagttttcttgcatgagtgcaggagaggtcactgcaggaggagaacaaggctctgcagaaggaagtaagttgtcgaaaatatagtatttactgctgcttatattaattaattcattctgcttgactagccaatggaggcactaaacataattaattcatgcgcattggttttgatcaattgatttatcttgttgacaattttccaatctatccatgggtttaattactagttttgtcaatggaggcattagagataattaattcatatgcgcactcgaaagtttgaaattgctgtagtttacttgttgggtggatcatatcgccaataattttttcccccacagttgaccgcaaatgagaagtaattttctttgccttctagacttgacggctatttttttagcgtgttggcaattgaacatatgaccttgggttaaaaccacacatcttttatcattgcgctatcaaatacatctcgataaatttgtcccttactagcggtttatgtggtttccttggtggtcggtttgtgcctcttagaaaaaaatcgtgatgtttgtagtgtgcgcatgcagctggtggagaggcagaagaatgtgaggggccagcagcaagtagggcagtgggaccaaacccaggtccaggcccaggcccaagcccaaccccaagcccagacaagctcctcctcctcctccatgctgagggatcagcaggcacttcttccaccacaaaatatctggtacgtatatgtctgcattcatgtctcatcagttgctattcagttataaattaatctgttactgcactaattaagatcgatcacacccttgttaagttctaagtctctaattaattaactgcatgtatataattatgcacatctgtgcatagtagctacccgccggtgatgatgggcgagagaaatgatgcggcggcggcggcggcggtggcggcgcagggccaggtgcaactccgcatcggaggtcttccgccatggatgctgagccacctcaatgcttaagatgatcatcgtcgtcgtcgtcggccaaacagctgccgtatgcaccgtgaatcatgggagcaaccttgaatgaattgaagtcattggtatcgatcctagcgataatatatatgattctcctaaaatgaaattgatctcaaaaaaacaaacctagcgattaagctattcttatatatgtgtttgcctgctgccccctaccctacaggctacatatgatttgcaagaaattaattatgagcaaggatcaggatgtgtctttgtgtaatcatcagcacgtacctagtgcttcctactgatatatatgcatgcaattgtgtgcatataaatatatttgcatgccatgctcccgtgatggttaattaatttatgattgtgtttatacgctaattaactgcagatgcaaactaatcaatcgaattat</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0108900, RefSeq:Os07g0108900