Difference between revisions of "Os05g0445900"

From RiceWiki
Jump to: navigation, search
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
Cytosine DNA methylation, which occurs in the CG, CHG(H = A, C or T) and CHH sequence contexts, is an epigenetic modification in plants. As well, there are some proteins coded for DNA demethylation. The genes and the corresponding encoded enzymes that mediate DNA methylation and demethylation have been characterized mainly in Arabidopsis. The Arabidopsis enzymes that mediate 5-methylcytosine (5-meC) DNA demethylation are DEMETER (DME), REPRESSOR OFSILENCING 1 (ROS1),DEMETER-LIKE 2 (DML2) and DEMETER-LIKE 3 (DML3). Phylogenetic analysis revealed that the rice (Oryza sativa)genome encodes six putative bi-functional DNA glycosylases that mediate cytosine DNA demethylation: four ROS1orthologs and twoDML3orthologs, but no DME orthologs.It has been demonstrated that rice ROS1a protein is a bi-functional DNA glycosylase/lyase for 5-meC DNA demethylation, although biochemical characterization of the ROS1a enzyme remains to be performed to confirm this.
 +
ROS1a is the most abundantly expressed gene in tissues. It was recently reported that null mutants of ROS1c, which encodes a 5-meC DNA glycosylase/lyase, show no effects on transmission of the null alleles and produce a small portion of wrinkled seeds.And the null mutation, ros1a-GUS1, was hardly ever transmitted to progeny.Even in the presence of the wild-type paternal ROS1a allele, the maternal nullros1a-GUS1allele caused failure of early stage endosperm development, indicating non-equivalent contribution of maternal and paternal ROS1a to endosperm development.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
Rice contains four ROS1 orthologs and two DML3 orthologs tentatively named ROS1a–d and DML3a and DML3b, that contain characteristic DNA glycosylase domains flanked by conserved domains of unknown functions. Of these, ROS1ais the longest gene, comprising 17 exons that encode a protein with 1952 amino acids, and 5¢ and 3¢ UTRs of 73 and 607 bp, respectively. RT-PCR analysis revealed thatROS1awas expressed in all vegetative and reproductive tissues tested . Quantitative RT-PCR analysis revealed that ROS1ais the most extensively expressed gene among the four genes(ROS1a, ROS1c, ROS1d and DML3a) expressed in five selected tissues examined, including anthers and pistils,whereas ROS1b and DML3bare scarcely expressed in these tissues. Interestingly, moderate levels of transcripts for ROS1c, ROS1dandDML3awere detected in pistils and immature seeds 2 days after pollination.
 +
 
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
Cytosine DNA methylation, which occurs in the CG, CHG(H = A, C or T) and CHH sequence contexts, is an epigenetic modification in plants. The genes and the corresponding encoded enzymes that mediate DNA methylation and demethylation have been characterized mainly in Arabidopsis. The Arabidopsis enzymes that mediate 5-methylcytosine (5-meC) DNA demethylation [DEMETER (DME), REPRESSOR OFSILENCING 1 (ROS1),DEMETER-LIKE 2 (DML2) and DEMETER-LIKE 3 (DML3) are bi-functional DNA glycosylases that not only recognize and remove5-meC from double-stranded DNA, but also show lyase activity, which nicks double-stranded DNA at an abasic site.Phylogenetic analysis revealed that the rice (Oryza sativa)genome encodes six putative bi-functional DNA glycosylases that mediate cytosine DNA demethylation: four ROS1 orthologs and two DML3 orthologs, but no DME orthologs.Rice endosperm DNA is hypomethylated in all sequence contexts, implying that hypomethylation in rice endosperm relies on some of these DNA glycosylases or alternative biochemical mechanisms.
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
Line 17: Line 19:
  
 
==References==
 
==References==
Please input cited references here.
+
1.A. Zemach et al., Local DNA hypomethylation activates genes in rice endosperm. Proc Natl Acad Sci U S A 107, 18729 (Oct 26, 2010).
 +
2.A. Ono et al., A null mutation of ROS1a for DNA demethylation in rice is not transmittable to progeny. Plant J 71, 564 (Aug, 2012).
 +
 
  
 
==Structured Information==
 
==Structured Information==

Revision as of 03:21, 5 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Cytosine DNA methylation, which occurs in the CG, CHG(H = A, C or T) and CHH sequence contexts, is an epigenetic modification in plants. As well, there are some proteins coded for DNA demethylation. The genes and the corresponding encoded enzymes that mediate DNA methylation and demethylation have been characterized mainly in Arabidopsis. The Arabidopsis enzymes that mediate 5-methylcytosine (5-meC) DNA demethylation are DEMETER (DME), REPRESSOR OFSILENCING 1 (ROS1),DEMETER-LIKE 2 (DML2) and DEMETER-LIKE 3 (DML3). Phylogenetic analysis revealed that the rice (Oryza sativa)genome encodes six putative bi-functional DNA glycosylases that mediate cytosine DNA demethylation: four ROS1orthologs and twoDML3orthologs, but no DME orthologs.It has been demonstrated that rice ROS1a protein is a bi-functional DNA glycosylase/lyase for 5-meC DNA demethylation, although biochemical characterization of the ROS1a enzyme remains to be performed to confirm this. ROS1a is the most abundantly expressed gene in tissues. It was recently reported that null mutants of ROS1c, which encodes a 5-meC DNA glycosylase/lyase, show no effects on transmission of the null alleles and produce a small portion of wrinkled seeds.And the null mutation, ros1a-GUS1, was hardly ever transmitted to progeny.Even in the presence of the wild-type paternal ROS1a allele, the maternal nullros1a-GUS1allele caused failure of early stage endosperm development, indicating non-equivalent contribution of maternal and paternal ROS1a to endosperm development.

Expression

Rice contains four ROS1 orthologs and two DML3 orthologs tentatively named ROS1a–d and DML3a and DML3b, that contain characteristic DNA glycosylase domains flanked by conserved domains of unknown functions. Of these, ROS1ais the longest gene, comprising 17 exons that encode a protein with 1952 amino acids, and 5¢ and 3¢ UTRs of 73 and 607 bp, respectively. RT-PCR analysis revealed thatROS1awas expressed in all vegetative and reproductive tissues tested . Quantitative RT-PCR analysis revealed that ROS1ais the most extensively expressed gene among the four genes(ROS1a, ROS1c, ROS1d and DML3a) expressed in five selected tissues examined, including anthers and pistils,whereas ROS1b and DML3bare scarcely expressed in these tissues. Interestingly, moderate levels of transcripts for ROS1c, ROS1dandDML3awere detected in pistils and immature seeds 2 days after pollination.


Evolution

Cytosine DNA methylation, which occurs in the CG, CHG(H = A, C or T) and CHH sequence contexts, is an epigenetic modification in plants. The genes and the corresponding encoded enzymes that mediate DNA methylation and demethylation have been characterized mainly in Arabidopsis. The Arabidopsis enzymes that mediate 5-methylcytosine (5-meC) DNA demethylation [DEMETER (DME), REPRESSOR OFSILENCING 1 (ROS1),DEMETER-LIKE 2 (DML2) and DEMETER-LIKE 3 (DML3) are bi-functional DNA glycosylases that not only recognize and remove5-meC from double-stranded DNA, but also show lyase activity, which nicks double-stranded DNA at an abasic site.Phylogenetic analysis revealed that the rice (Oryza sativa)genome encodes six putative bi-functional DNA glycosylases that mediate cytosine DNA demethylation: four ROS1 orthologs and two DML3 orthologs, but no DME orthologs.Rice endosperm DNA is hypomethylated in all sequence contexts, implying that hypomethylation in rice endosperm relies on some of these DNA glycosylases or alternative biochemical mechanisms.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

1.A. Zemach et al., Local DNA hypomethylation activates genes in rice endosperm. Proc Natl Acad Sci U S A 107, 18729 (Oct 26, 2010). 2.A. Ono et al., A null mutation of ROS1a for DNA demethylation in rice is not transmittable to progeny. Plant J 71, 564 (Aug, 2012).


Structured Information

Gene Name

Os05g0445900

Description

Similar to ROS1 (Fragment)

Version

NM_001062220.1 GI:115464170 GeneID:4338940

Length

5779 bp

Definition

Oryza sativa Japonica Group Os05g0445900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:21889157..21894935

Sequence Coding Region

21889581..21889708,21890545..21890583,21890664..21890778,21890883..21890948,21892020..21892159
,21892239..21892302,21892380..21892416,21892564..21893001,21893713..21893795
,21893897..21893933,21894150..21894218,21894322..21894413,21894487..21894571
,21894906..21894934

Expression

GEO Profiles:Os05g0445900

Genome Context

<gbrowseImage1> name=NC_008398:21889157..21894935 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:21889157..21894935 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>ttaagagatgttcctccagactcagcaaaggactatctgcttagtatacgtggattggggctcaaaagtgttgagtgtgtccgccttttgacattacatcatcttgcattcccagttgatactaatgttggtcgtatatgtgtacgattgggatgggtgccaattcaacccctccctgaatctcttcagttacaccttctggagctataccctgtcttggagactatacaaaagtacctctggcctcgtctgtgtaaacttgatcaacaaacactgtatgagttacattatcagatgattacttttggaaaggtgttctgtaccaaaagcaagccgaattgcaatgcatgtccaatgaggagtgaatgcaggcattttgcaagtgcctttgcaagtgcaagacttgcacttccttctcctcaggacaaaaggttggtgaatctgagcaatcaatttgctttccataatggcacaatgcccacaccaaattcaactcctctgcctcagctcgaggggagtatccatgcaagggatgttcatgctaacaacacaaatccaataattgaggagccagcaagtccaagagaggaagaatgccgagaacttttagagaatgatattgaagattttgatgaagatactgatgaaatcccaataataaaacttaacatggaagctttttctcaaaacttggaaaattgcataaaagaaagcaataaggatttccaatctgatgatattacaaaagcattggttgctatcagcaatgaagcagcttcaattcctgtacctaaactaaagaatgtgcatagacttcggacagaacactatgtttacgaacttccagattcacatcccctcatgcaacagctagcactcgaccaacgggagcctgatgatccaagtccttacctgttggccatatggacaccagatgaactaaaggacacaagggaggcaccaaaaccgtgctgcaatcctcaaactgaaggtggcttatgcagcaatgagatgtgccacaactgtgtatctgaacgagaaaaccaatatagatacgtcagaggcacggttctggttccttgccgaacagccatgagaggtagttttccacttaatggcacttactttcaagttaatgaggtttttgctgatcacagttctagccacaatcccataaatatcccaagggagcagttatggaacttgcataggcgtatggtttactttgggacttcagtgccaaccatattcaaaggtctaacaactgaagaaatacagcactgcttctggagaggatttgtctgtgtgagaggattcaacatggaaactagggcaccaaggcctctatgcccccatttccaccttgcagcaagcaaactgcgaagatcctctaaaaaagcagcaactgagcaaacacactga</cdnaseq>

Protein Sequence

<aaseq>LRDVPPDSAKDYLLSIRGLGLKSVECVRLLTLHHLAFPVDTNVG RICVRLGWVPIQPLPESLQLHLLELYPVLETIQKYLWPRLCKLDQQTLYELHYQMITF GKVFCTKSKPNCNACPMRSECRHFASAFASARLALPSPQDKRLVNLSNQFAFHNGTMP TPNSTPLPQLEGSIHARDVHANNTNPIIEEPASPREEECRELLENDIEDFDEDTDEIP IIKLNMEAFSQNLENCIKESNKDFQSDDITKALVAISNEAASIPVPKLKNVHRLRTEH YVYELPDSHPLMQQLALDQREPDDPSPYLLAIWTPDELKDTREAPKPCCNPQTEGGLC SNEMCHNCVSERENQYRYVRGTVLVPCRTAMRGSFPLNGTYFQVNEVFADHSSSHNPI NIPREQLWNLHRRMVYFGTSVPTIFKGLTTEEIQHCFWRGFVCVRGFNMETRAPRPLC PHFHLAASKLRRSSKKAATEQTH</aaseq>

Gene Sequence

<dnaseqindica>5228..5355#4353..4391#4158..4272#3988..4053#2777..2916#2634..2697#2520..2556#1935..2372#1141..1223#1003..1039#718..786#523..614#365..449#2..30#gttaagagatgttcctccagactcagcaaagtaagatactacacctgtattcaatatttacaaatcccattgccctgctgatgagatttttctagttctggaaatgataaatcaagtatcaaagaagtttgtgaaccaattaaatggagcaagctgatccaagaacttgccagttaatatctagaattaaatactatgagcaaagttctatgaaatgggcacgcagaacagaaaaggctgtataatgtatgacacatgatcgaagcagtgaaggaatttttttttaggaaagaaaattccatgaaccctatttatttcacaggcgagaagtatgtcaattacaatgtgttcgaattattttcagggactatctgcttagtatacgtggattggggctcaaaagtgttgagtgtgtccgccttttgacattacatcatcttgcattcccagtaagtttctgttggattaattctccttcacctgcagccaatttgaaatttacactacattgttgcaactcaggttgatactaatgttggtcgtatatgtgtacgattgggatgggtgccaattcaacccctccctgaatctcttcagttacaccttctggagctgtaagaatgttgcattgtctactacagttgtataaatactctctgcaattttatacgatgatgtttcaatttgaatatattgattttgtttgtgccttcaaagataccctgtcttggagactatacaaaagtacctctggcctcgtctgtgtaaacttgatcaacaaacactgtgagttataaccaattaaccatacccactcatagttgcccttcttattagtttttttttacgcaagcccttcttattagtttgtgtaacttctaggttatttctttttcatgcaaattacagtatttggaatcatgaataattaaggcaataaggagtaaataacataatttataactataaggaattattaacagagtttcatggttttcacaggtatgagttacattatcagatgattacttttggaaaggtacttcattagcattaaggagtttggtctcttcattagcatctaccgacgcatttgttctcttttgtttgagtaaagataaattatcataacaaatgcaggtgttctgtaccaaaagcaagccgaattgcaatgcatgtccaatgaggagtgaatgcaggcattttgcaagtgcctttgcaaggtattatggcaagcagaaaatgggagccttctggctgcaaggagacttacaaaataaacactatttgcttcagtagtcacttttttccgataaaggaagctttattaaaactcagtcaaatacaccaagatgatacattctaactgagccactcccggcctctgcatgaaatgcacaccgccacaaaacaggatctaactagaccctcaacacaaaacaaataaattagtgactatcaagccgtagactatatcgccacccatgctccagggtaaaaaactcctgtgccacctgatagtgcacagcaaaaaccacgagaaggatgtgctttcgttggtggagagaccgaattagctccattaacataatatgaccactaagagcgcaaaatagtgcttttgaagaataaaagggaaaatatgctaggagaaaaatcaatatatggttctagtacaccgccatggcactttgtgtagtctctgtctgcaacaaaatatatttgccgctttcacttatcttacctgggaattttgttatcacgtatttcctcgttccactatctttcttgttttgtttgtgcgcgcgcgcatgcctgatatatcttgctctttcagttgaccttacctgggagccttcattttgcatatttcttcatttgttattttttccttattaactctgttatattttgtttgacttttttaaatgaagtgcaagacttgcacttccttctcctcaggacaaaaggttggtgaatctgagcaatcaatttgctttccataatggcacaatgcccacaccaaattcaactcctctgcctcagctcgaggggagtatccatgcaagggatgttcatgctaacaacacaaatccaataattgaggagccagcaagtccaagagaggaagaatgccgagaacttttagagaatgatattgaagattttgatgaagatactgatgaaatcccaataataaaacttaacatggaagctttttctcaaaacttggaaaattgcataaaagaaagcaataaggatttccaatctgatgatattacaaaagcattggttgctatcagcaatgaagcagcttcaattcctgtacctaaactaaagaatgtgcatagacttcggacagaacactatgtgtaagtgttggactgatattttatttagcttgaacatgtacctgtttaaacttacatttattatagagcccaccatctaagtaattctatacatcctgaacaaaatattttttaatttctattactgacttaaggttctgctcgcagttacgaacttccagattcacatcccctcatgcaacaggtgagaccatgagaaattgtgccatctttctttaaaacacttcaagatattatttctgattgcaaatgatcttacagctagcactcgaccaacgggagcctgatgatccaagtccttacctgttggccatatggacaccaggcaagtgcatttttctttaaatttataactgtccgtgtgtgtgtgctggttttcgtcgagtcatgtggctactgtgcagatgaactaaaggacacaagggaggcaccaaaaccgtgctgcaatcctcaaactgaaggtggcttatgcagcaatgagatgtgccacaactgtgtatctgaacgagaaaaccaatatagatacgtcagaggcacggttctggtaaatcaaccaacattatgtagcaatcatcaacattgaagagctgaacctctgcattagtcagctagtaaacaaaatattcattataatccaaacattggaatgaattcaggaattcaagaaaatgttgaagataacttttaatgaaaactagtgcttacaaagtgccaagcaaagctattctgttgtctgtgtaatctcttttcttgcatgaaatagcccactgtcttcactttaaacaataagaatagcatagattttgggtttccggctatacaacacatcttaatatgaacttttgtggaagtctaaaagagaacctctctgaacctttaaactgtacactatttaaccaacaatcaaagccgatcacttctcaacgtcattctgaattagctttgggcgatgtttcttaaccaggagatgtggtctgagattttagattttttttttcatctcctttatattagtagacgacttaaaattttctggaataatcttacttcgctgtgaagtatttataacccagataaatcggtaagattgaagtaaagtattattgtcccacgaaatttagtgtgtgaaagtagacaacatttttttctactgtccgattaaactttatttaactctgccccattttatctaggctataaatggtgatttcttctaggctatacggtttttcaatccaattttaccttattttgctttaccaaatttgtcaacattataatactttgtagtgcaagtgagattttttttttcaattttgttatgtcatttactaattttaaaattgaaaacctggttcagccttgggccattttgccacattagggacacatagtccaaagccactttaaatttgagacaaggttgaaaagcgcatggttttgatacttcaggttctgggttgaattgtgtccagttttctgctttggggttgtctctggactaacagaaaagttcagtattgcaaaacagactgtttcctatacaatcatgcattgttggtttgtgaagttgcaagtattgcttgactaatgacggttactggaacatgaacaggttccttgccgaacagccatgagaggtagttttccacttaatggcacttactttcaagttaatgaggtatgctgagttatatctgtcaaagtatgagtaggatagtggagagttgctatccatgggcctttatagagttgactttacgatttctggatttgtttttgcaggtttttgctgatcacagttctagccacaatcccataaatatcccaagggagcagttatggaacttgcataggcgtatggtttactttgggacttcagtgccaaccatattcaaaggttaccaccattcacccatacaatgactcaaagaaatcttatctgcaactttaccgacaactgttattttcattctttaggtctaacaactgaagaaatacagcactgcttctggagaggtattaacagtatttttttcactcgctgtttcagcgcattctcctctgggacatatcttgtttcctcatatgatcaaacaatttgcagaatgcagatgccatcatataatcacaatatgtttctacagttatatagcattcgtgtgattgtgtcaaggtgtccacacacttttcacaaaaacttactccccctgtcccataatataagggattttgagcttttgtttgcactgtttgaccattcgtcttattcaaaaaaatttagaattatattttttttctttgtgacttactttattatccaaaatactttaagcacaacttttcgttttttatatttgcacaaattttttgaataagacgagtggtcaaacattataatcaaaaaactcaaaatcccttgtattatgggacggagggagtagtattaagggtctaaaaggagcctgaatatttggttcagttagagtctatatctgagtccattttaattcctagtgctatggataaaggtgtcctccttcaataaataaataaaggtctctccagttattagtcaccagcatccaatataactgcctgataatatatgtggtaagttatatggtgccaaagaggcaaagatactgctaccatgactaaccccctttttttttctgagttaataagggtgttagcatacatatagcttccaaattggtttagttaggtggaaaaagtcgtcatttcaggatgcagatataagttagggcatatcctcttgttggggttttcatttcagctgtgtcttatactttatatggtgtctcattaacatgcactaaaatgcaatgcaggatttgtctgtgtgagaggattcaacatggaaactagggcaccaaggcctctatgcccccatttccaccttgcagcaagcaaactgcgaagatcctctaaaaaagcagcaactgagcaaacacactgatttcaacagggacatatcaattctataaaataatgttgatggtgattacatcagttctcgatctgtgcatgggtcatattagttcctgcaggacgatagccattcttctaggaaataaacagtggagttggaaacagttaactttaagatgtgggagccaattgggcacgagaaagcaccaatatttcatatgcacctctggggcaggtcggatgcggatcatcatcatcagttaacatgggcgtagaatatcattccgttttttttttctgtggctttggtgtatcttattcacttttcatttgttttatccattcaactagcttgccaagagaccttaccatctgttctcatgacatgttagtttttcagaacttatagcaggtagtaccttcatattgatgatatgactttgattttcatt</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0445900, RefSeq:Os05g0445900