Difference between revisions of "Os01g0805600"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
The cell cycle is an important process during seed development in plants and its progression is driven by a number of core regulators such as the cyclins. Currently, however, little is known regarding the role of the cyclins in embryo and endosperm development in cereals. In our current study, we show that the knockdown of Orysa;CycB1;1 in rice results in the production of abnormal seeds, which at maturity contain only an enlarged embryo. It was further found that a delayed and abnormal cellularization occurred in the endosperm in these knockdown seeds which eventually became abortive. Moreover, the observed development of the enlarged embryo was also morphologically abnormal and found to be caused by an enlarged cell size rather than an increased cell number. Expression analysis showed that Orysa;CycB1;1 transcripts were localized in the endosperm and embryo. Genome-wide transcriptional profiling further indicated that a large number of genes are responsible for the phenotype of the enlarged embryo. The results of the knockdown of Orysa;CycB1;1 via an endosperm or an embryo-specific promoter also suggest that the enlarged embryo may be correlated to the abortive endosperm. Our results suggest that Orysa;CycB1;1 expression is critical for endosperm formation via the regulation of mitotic division, and that the endosperm plays an important role in maintenance of embryo development in rice.
+
The cell cycle is an important process during seed development in plants and its progression is driven by a number of core regulators such as the cyclins. Currently, however, little is known regarding the role of the cyclins in embryo and endosperm development in cereals. In current study, we show that the knockdown of Orysa;CycB1;1 in rice results in the production of abnormal seeds, which at maturity contain only an enlarged embryo. It was further found that a delayed and abnormal cellularization occurred in the endosperm in these knockdown seeds which eventually became abortive. Moreover, the observed development of the enlarged embryo was also morphologically abnormal and found to be caused by an enlarged cell size rather than an increased cell number. Expression analysis showed that Orysa;CycB1;1 transcripts were localized in the endosperm and embryo. Genome-wide transcriptional profiling further indicated that a large number of genes are responsible for the phenotype of the enlarged embryo. The results of the knockdown of Orysa;CycB1;1 via an endosperm or an embryo-specific promoter also suggest that the enlarged embryo may be correlated to the abortive endosperm. The results suggest that Orysa;CycB1;1 expression is critical for endosperm formation via the regulation of mitotic division, and that the endosperm plays an important role in maintenance of embryo development in rice.
  
 
===Expression===
 
===Expression===

Revision as of 07:59, 5 June 2014

Please input one-sentence summary here.

Annotated Information

Function

The cell cycle is an important process during seed development in plants and its progression is driven by a number of core regulators such as the cyclins. Currently, however, little is known regarding the role of the cyclins in embryo and endosperm development in cereals. In current study, we show that the knockdown of Orysa;CycB1;1 in rice results in the production of abnormal seeds, which at maturity contain only an enlarged embryo. It was further found that a delayed and abnormal cellularization occurred in the endosperm in these knockdown seeds which eventually became abortive. Moreover, the observed development of the enlarged embryo was also morphologically abnormal and found to be caused by an enlarged cell size rather than an increased cell number. Expression analysis showed that Orysa;CycB1;1 transcripts were localized in the endosperm and embryo. Genome-wide transcriptional profiling further indicated that a large number of genes are responsible for the phenotype of the enlarged embryo. The results of the knockdown of Orysa;CycB1;1 via an endosperm or an embryo-specific promoter also suggest that the enlarged embryo may be correlated to the abortive endosperm. The results suggest that Orysa;CycB1;1 expression is critical for endosperm formation via the regulation of mitotic division, and that the endosperm plays an important role in maintenance of embryo development in rice.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0805600

Description

Similar to Cyclin IaZm (Fragment)

Version

NM_001051097.1 GI:115440564 GeneID:4327547

Length

1749 bp

Definition

Oryza sativa Japonica Group Os01g0805600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:35905304..35907052

Sequence Coding Region

35905567..35905702,35905800..35905978,35906084..35906257,35906345..35906593,35906696..35906821
,35906929..35907051

Expression

GEO Profiles:Os01g0805600

Genome Context

<gbrowseImage1> name=NC_008394:35905304..35907052 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:35905304..35907052 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atcagctctgattctgaccagagcatgaggcagcagtcggagggcagcgccagctctgtccgcaagtgctcgaggaagaaggtcatcaacaccctcacctccgtgctcactgcacgatcaaaggttgcctgtggaatcactgacaaacctcgagaagtgattgaggacattgacaagctcgacggtgacaatgagctggctgtggtggactatattgaggatatctacaagttctacaaggtcgctgagaacgagtgccgcccgtgtgattacatcgacacccaggtggagatcaattccaagatgagggccatcctggcagactggataattgaagtgcatcacaagtttgagctcatgccagagaccctatacctctccatgtatgtcatcgaccggtacctctcgatgcagcaagtgcagcggagggagctgcagctggtaggtgtctctgccatgctgatagcttgcaagtacgaggagatttgggccccagaggtgaacgacttcatcttgatatcagatagtgcatacactagggaacagattcttgcaatggagaaggggattctgaataagcttcagtggaatctcaccgttcctacagcatatgtcttcattatgcgctatctgaaggcgggggcgtctgcagataacaaaagtgacaaggagatggagcacatggccttcttcttcgctgaattggcactgatgcagtacgggctggtggcatccctgccttccaaggttgctgcctctgctgtctatgcagccaggctcaccctgaagaagagccctctatggactgacactctcaagcaccacactggatttaccgagtcacagctattggactctgcaaagcttcttgttacctcgcactctactgcccctgagagcaagctgagggttgtgtacaagaagtattccagtgagcagcttggaggagtggcacttcgctcaccagcagtggaactctgcaaataa</cdnaseq>

Protein Sequence

<aaseq>ISSDSDQSMRQQSEGSASSVRKCSRKKVINTLTSVLTARSKVAC GITDKPREVIEDIDKLDGDNELAVVDYIEDIYKFYKVAENECRPCDYIDTQVEINSKM RAILADWIIEVHHKFELMPETLYLSMYVIDRYLSMQQVQRRELQLVGVSAMLIACKYE EIWAPEVNDFILISDSAYTREQILAMEKGILNKLQWNLTVPTAYVFIMRYLKAGASAD NKSDKEMEHMAFFFAELALMQYGLVASLPSKVAASAVYAARLTLKKSPLWTDTLKHHT GFTESQLLDSAKLLVTSHSTAPESKLRVVYKKYSSEQLGGVALRSPAVELCK</aaseq>

Gene Sequence

<dnaseqindica>1351..1486#1075..1253#796..969#460..708#232..357#2..124#gatcagctctgattctgaccagagcatgaggcagcagtcggagggcagcgccagctctgtccgcaagtgctcgaggaagaaggtcatcaacaccctcacctccgtgctcactgcacgatcaaaggtgggttatccactgaaaatttcaaaaagaaaaaaaaaattctgcataccaatcactgacaggttatcttaagttcttaacctgtatttactccatgctaatgccaggttgcctgtggaatcactgacaaacctcgagaagtgattgaggacattgacaagctcgacggtgacaatgagctggctgtggtggactatattgaggatatctacaagttctacaaggtcgctgaggtaactgagtcgctctctctgcttgatccttcttcgatgcctacgcaaatgctgtatgtgcttggtcactgaaaggtgcaatctttcctggccttgctgcagaacgagtgccgcccgtgtgattacatcgacacccaggtggagatcaattccaagatgagggccatcctggcagactggataattgaagtgcatcacaagtttgagctcatgccagagaccctatacctctccatgtatgtcatcgaccggtacctctcgatgcagcaagtgcagcggagggagctgcagctggtaggtgtctctgccatgctgatagcttgcaagtacgaggagatttgggccccagaggtagcaacatttttagcccctttgctctgcactgcccatttctagcagggacttgttctgattggatctctgtctatgtatttgcaggtgaacgacttcatcttgatatcagatagtgcatacactagggaacagattcttgcaatggagaaggggattctgaataagcttcagtggaatctcaccgttcctacagcatatgtcttcattatgcgctatctgaaggcgggggcgtctgcagataacaaaagtgacaaggaggtaaagagccatggcttctgtttgtttctgtttaccatcggattatatttcattgctaagcaacaagtttgagcgtgtactcaaaatttcttttggtgaatgcagatggagcacatggccttcttcttcgctgaattggcactgatgcagtacgggctggtggcatccctgccttccaaggttgctgcctctgctgtctatgcagccaggctcaccctgaagaagagccctctatggactgacactctcaagcaccacactggatttaccgagtcacagctattgtaagcactacatgactcgatgacttgtttaactagcatcactgaaattctccattgagcagatatactgaactttatttttctgcgatgatttcagggactctgcaaagcttcttgttacctcgcactctactgcccctgagagcaagctgagggttgtgtacaagaagtattccagtgagcagcttggaggagtggcacttcgctcaccagcagtggaactctgcaaataaatggagattagctttgtctcgtatttcgtttgcttatttggtttagagtgcaatggaaggcgagtctgacattcattaggcgtttgcttgttttggagtcaagaaagtttggaatcttgacacgcttgctatgacttctaatggccaggatttggcctttatgtgataatacaccttggtgtatataaactgtcatctgaatcttatcaataacggttcttgataagtatgaatgatgatcgaattacatgtttgcatacaac</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0805600, RefSeq:Os01g0805600