Os07g0214100

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Seed allergenic protein

RAG1 shows complete agreement with the cDNA clone, RA17, suggesting that cDNA clone RA17 is derived from RAG1 gene transcripts. On the other hand, RAG2 displays strong homology (97.2 ~o identity) with another eDNA clone, RA 14 (Table 1). Two RA genes are located divergently at a distance of 4 kb. The 5' region of RAG1 gene has relatively long direct repeat units (about 170 bp), three 22 bp direct repeat units, and two 12 bp direct repeat units (Fig. 3). In addition, six and two 8 bp direct repeat units (ATGCAAAA) overlined in Fig. 3 exist in RAG 1 and RAG2 promoters, respectively (Table 2). DNA blotting analysis of completely digested rice genomic DNA was performed as described in Materials and methods using the Nco I-Eco RI eDNA (RA17) probe encoding a complete mature RA. Three hybridizing bands were observed in lanes 2 and 3 (Fig. 4). About 6 kb fragment in The synthetic oligonucleotide primer is complementary to 17 nucleotide sequence (numbered 62 to 78 in Fig. 3) that corresponds to the potential signal sequence of the clone, RAG1. Total RNA prepared from rice seed at 20 DAF was analyzed by using the synthetic oligonucleotide primer. The result of primer extension analysis is shown in Fig. 5. Primer-extended products detected here would be derived mainly from RAG1 gene tran-scripts because the population of its cDNA, RA17, is dominant in the cDNA library. The 5' end of RA gene transcripts was expected to be at the position of A (numbered -26 in Fig. 3), though other minor bands were also detected, suggesting that the transcriptional initiation site of RAG1 is 26 bp upstream of the translational initiation codon, ATG. The distance between the transcriptional initiation site and the translational initiation site of RAG 1 gene complies with that of most plant genes [10]. In the 5' region, the putative TATA box and CAAT box exists about 45 bp and 147 bp upstream of the transcriptional initiation site, respectively. The transcriptional initiation site of RAG2 gene might be the same as that of RAG1 gene since the nucleotide sequence around comparable region resembles each other.

Expression

Please input expression information here. Stage- and tissue-specific expression of RA gene To investigate the expression of RA genes, total RNA and protein were prepared from rice seeds at different stages of maturation (5, 10, 15, 20, 25, and 30 DAF), and from other tissues. RNA and protein preparations were used for RNA blotting and immunoblotting analyses, respectively. The mRNA of RA was detected only in ripening seed (lane 4 in Fig. 6A) but not in leaves, stalks, and roots (lanes 1, 2, and 3, respectively, in Fig. 6A). RA mRNA accumulated from 10 DAF and reached its maximum level at 15 to 20 DAF (lanes 3 and 4 in Fig. 6B). Immunoblotting analysis showed that the protein synthesis was consistent with the accumulation of RA mRNAs (data not shown). In conclusion, RA gene expression is controlled in transcription level.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name	Os07g0214100
Description	Seed allergenic protein RA17 precursor
Version	NM_001065719.1 GI:115471170 GeneID:4342722
Length	640 bp
Definition	Oryza sativa Japonica Group Os07g0214100, complete gene.
Source	Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome	Chromosome 7
Location	Chromosome 7:6287055..6287694
Sequence Coding Region	6287180..6287671
Expression	GEO Profiles:Os07g0214100
Genome Context	<gbrowseImage1> name=NC_008400:6287055..6287694 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>
Gene Structure	<gbrowseImage2> name=NC_008400:6287055..6287694 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>
Coding Sequence	<cdnaseq>atggcttccaacaaggtagtgttctcggtattgctcctcgtcgttctctccgtgctcgcggcggcgatggcgaccatggcggaccaccaccaagtctacagccccggtgagcaatgtcggccaggaataagctatccgacatactcactcccgcaatgtcgaacattggtgaggcgccaatgcgttggccgtggcgcggccagcgccgcggacgagcaagtctggcaagactgctgccggcagctcgccgccgtcgacgacggctggtgcaggtgcggggcgctcgatcacatgctgtcaggcatctacagggagctcggcgccaccgaggccgggcaccccatggccgaggtgttccccggctgccggagaggggacttggagcgcgcggcggcgagcctcccggcgttctgcaacgtggacatccccaatgggcctggtggtgtctgctactggcttgggtatcctaggaccccaagaaccggtcactag</cdnaseq>
Protein Sequence	<aaseq>MASNKVVFSVLLLVVLSVLAAAMATMADHHQVYSPGEQCRPGIS YPTYSLPQCRTLVRRQCVGRGAASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGI YRELGATEAGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGPGGVCYWLGYPRTPR TGH</aaseq>
Gene Sequence	<dnaseqindica>24..515#atttttcacaaactaagcaaaatatggcttccaacaaggtagtgttctcggtattgctcctcgtcgttctctccgtgctcgcggcggcgatggcgaccatggcggaccaccaccaagtctacagccccggtgagcaatgtcggccaggaataagctatccgacatactcactcccgcaatgtcgaacattggtgaggcgccaatgcgttggccgtggcgcggccagcgccgcggacgagcaagtctggcaagactgctgccggcagctcgccgccgtcgacgacggctggtgcaggtgcggggcgctcgatcacatgctgtcaggcatctacagggagctcggcgccaccgaggccgggcaccccatggccgaggtgttccccggctgccggagaggggacttggagcgcgcggcggcgagcctcccggcgttctgcaacgtggacatccccaatgggcctggtggtgtctgctactggcttgggtatcctaggaccccaagaaccggtcactaggctactatagttagctgtgtgtgtgtgactatgtggggttgctaaataattagtgctttcttttgtcaggaagcatctatttatatatatgtggtgaataaatgatgaacttcaatgttcttctg</dnaseqindica>
External Link(s)	NCBI Gene:Os07g0214100, RefSeq:Os07g0214100