Difference between revisions of "Os01g0194300"

From RiceWiki
Jump to: navigation, search
(Expression)
(Annotated Information)
Line 2: Line 2:
  
 
==Annotated Information==
 
==Annotated Information==
 +
Function
 
OsNPR1(also called NH1) may also play a central role in herbivoreinduced rice defense responses. It has been reported that transcript levels of OsNPR1are upregulated following infection by the bacterial blight Xanthomonas oryzae pv.oryzae (Xoo),the rice fungal blast Magnaporthe grisea and treatment with signal molecules, such as benzothiadiazole, methyl jasmonate and ET.OsNPR1 positively regulates expression of PR genes and rice resistance to bacterial blight disease  and fungal blast disease but negatively modulates resistance to the white-backed planthopper Sogatella furciferia.OsNPR1 may play a role in the reallocation of energy and resources during defense responses. However, how OsNPR1 mediates defenserelated signaling pathways and thus regulates the ability of rice to resist herbivores remains largely unknown.the rusult that OsNPR1 is involved in rice herbivore defense.
 
OsNPR1(also called NH1) may also play a central role in herbivoreinduced rice defense responses. It has been reported that transcript levels of OsNPR1are upregulated following infection by the bacterial blight Xanthomonas oryzae pv.oryzae (Xoo),the rice fungal blast Magnaporthe grisea and treatment with signal molecules, such as benzothiadiazole, methyl jasmonate and ET.OsNPR1 positively regulates expression of PR genes and rice resistance to bacterial blight disease  and fungal blast disease but negatively modulates resistance to the white-backed planthopper Sogatella furciferia.OsNPR1 may play a role in the reallocation of energy and resources during defense responses. However, how OsNPR1 mediates defenserelated signaling pathways and thus regulates the ability of rice to resist herbivores remains largely unknown.the rusult that OsNPR1 is involved in rice herbivore defense.
 
+
Expression
 
OsNPR1 in the herbivore-mediated induction of JA and ET pathways,and in the direct and indirect defenses of rice. transcript levels of OsNPR1
 
OsNPR1 in the herbivore-mediated induction of JA and ET pathways,and in the direct and indirect defenses of rice. transcript levels of OsNPR1
 
are upregulated when plants are treated by SA or JA.Interestingly, mechanical wounding enhances the mRNA levels of OsNPR1 quickly, whereas herbivore infestation elicits them more slowly ,much later than the time when the JA level in SSB-infested plants reaches its maximum (3 h after SSB infestation).It has been well documented that herbivore infestation elicits higher JA levels than does mechanical wounding in many plant species, including rice.Given an obvious inhibitory role ofOsNPR1on JA and ET biosynthesis ,it may be that rice plants perceive the herbivore infestation and then inhibit the increase in mRNA levels of OsNPR1at the early stage; thus,plants may prioritize JA- and ETdependent defense responses against herbivores. The increase in expression levels of OsNPR1at the later time points, which decreases the JA and ET levels, might be a regulation strategy of rice plants, resulting in appropriate defense responses according to the damage by the invader.
 
are upregulated when plants are treated by SA or JA.Interestingly, mechanical wounding enhances the mRNA levels of OsNPR1 quickly, whereas herbivore infestation elicits them more slowly ,much later than the time when the JA level in SSB-infested plants reaches its maximum (3 h after SSB infestation).It has been well documented that herbivore infestation elicits higher JA levels than does mechanical wounding in many plant species, including rice.Given an obvious inhibitory role ofOsNPR1on JA and ET biosynthesis ,it may be that rice plants perceive the herbivore infestation and then inhibit the increase in mRNA levels of OsNPR1at the early stage; thus,plants may prioritize JA- and ETdependent defense responses against herbivores. The increase in expression levels of OsNPR1at the later time points, which decreases the JA and ET levels, might be a regulation strategy of rice plants, resulting in appropriate defense responses according to the damage by the invader.

Revision as of 08:35, 5 June 2014

Please input one-sentence summary here.

Annotated Information

Function OsNPR1(also called NH1) may also play a central role in herbivoreinduced rice defense responses. It has been reported that transcript levels of OsNPR1are upregulated following infection by the bacterial blight Xanthomonas oryzae pv.oryzae (Xoo),the rice fungal blast Magnaporthe grisea and treatment with signal molecules, such as benzothiadiazole, methyl jasmonate and ET.OsNPR1 positively regulates expression of PR genes and rice resistance to bacterial blight disease and fungal blast disease but negatively modulates resistance to the white-backed planthopper Sogatella furciferia.OsNPR1 may play a role in the reallocation of energy and resources during defense responses. However, how OsNPR1 mediates defenserelated signaling pathways and thus regulates the ability of rice to resist herbivores remains largely unknown.the rusult that OsNPR1 is involved in rice herbivore defense. Expression OsNPR1 in the herbivore-mediated induction of JA and ET pathways,and in the direct and indirect defenses of rice. transcript levels of OsNPR1 are upregulated when plants are treated by SA or JA.Interestingly, mechanical wounding enhances the mRNA levels of OsNPR1 quickly, whereas herbivore infestation elicits them more slowly ,much later than the time when the JA level in SSB-infested plants reaches its maximum (3 h after SSB infestation).It has been well documented that herbivore infestation elicits higher JA levels than does mechanical wounding in many plant species, including rice.Given an obvious inhibitory role ofOsNPR1on JA and ET biosynthesis ,it may be that rice plants perceive the herbivore infestation and then inhibit the increase in mRNA levels of OsNPR1at the early stage; thus,plants may prioritize JA- and ETdependent defense responses against herbivores. The increase in expression levels of OsNPR1at the later time points, which decreases the JA and ET levels, might be a regulation strategy of rice plants, resulting in appropriate defense responses according to the damage by the invader.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0194300

Description

Similar to NPR1

Version

NM_001048821.1 GI:115435055 GeneID:4327315

Length

4605 bp

Definition

Oryza sativa Japonica Group Os01g0194300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:5059605..5064209

Sequence Coding Region

5059881..5060119,5060682..5060882,5061091..5061838,5063560..5064120

Expression

GEO Profiles:Os01g0194300

Genome Context

<gbrowseImage1> name=NC_008394:5059605..5064209 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:5059605..5064209 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagccgccgaccagccacgtcaccaacgcgttctccgactcggacagcgcgtccgtggaggaggggggcgccgacgcggacgccgacgtggaggcgctccgccgcctctccgacaacctcgccgcggcgttccgctcgcccgaggacttcgcgttcctcgccgacgcgcgcatcgccgtcccgggcggcggcggcggcggcggcgacctgctggtgcaccgctgcgtgctctccgcgcggagccccttcctgcgcggcgtcttcgcgcgccgcgccgccgccgccgcaggcggcggcggcgaggatggcggcgagaggctggagctccgggaactcctcggcggcggcggcgaggaggtggaggtcgggtacgaggcgctgcggctggtgctcgactacctctacagcggccgcgtcggcgacctgcccaaggcggcgtgcctctgcgtcgacgaggactgcgcccacgtcgggtgccaccccgccgtcgcgttcatggcgcaggtcctcttcgccgcctccaccttccaggtcgccgagctcaccaacctcttccagcggcgtctccttgatgtccttgataaggttgaggtagataaccttctattgatcttatctgttgccaacttatgcaacaaatcttgcatgaaactgcttgaaagatgccttgatatggtagtccggtcaaaccttgacatgattactcttgagaagtcattgcctccagatgttatcaagcagattattgatgcacgcctaagcctcggattaatttcaccagaaaacaagggatttcctaacaaacatgtgaggaggatacacagagcccttgactctgacgatgtagagctagtcaggatgctgctcactgaaggacagacaaatcttgatgatgcgtttgcactgcactacgccgtcgaacattgtgactccaaaattacaaccgagcttttggatctcgcacttgcagatgttaatcatagaaacccaagaggttatactgttcttcacattgctgcgaggcgaagagagcctaaaatcattgtctcccttttaaccaagggggctcggccagcagatgttacattcgatgggagaaaagcggttcaaatctcaaaaagactaacaaaacaaggggattactttggggttaccgaagaaggaaaaccttctccaaaagataggttatgtattgaaatactggagcaagctgaaagaagggacccacaactcggagaagcatcagtttctcttgcaatggcaggtgagagtctacgaggaaggttgctgtatcttgaaaaccgagttgctttggcgaggattatgtttccgatggaggcaagagtagcaatggatattgctcaagtggatggaactttggaatttaacctgggttctggtgcaaatccacctcctgaaagacaacggacaactgttgatctaaatgaaagtcctttcataatgaaagaagaacacttagctcggatgacggcactctccaaaacagtggagctcgggaaacgctttttcccgcgatgttcgaacgtgctcgacaagatcatggatgatgaaactgatccggtttccctcggaagagacacgtccgcggagaagaggaagaggtttcatgacctgcaggatgttcttcagaaggcattccacgaggacaaggaggagaatgacaggtcggggctctcgtcgtcgtcgtcatcgacatcgatcggggccattcgaccaaggagatga</cdnaseq>

Protein Sequence

<aaseq>MEPPTSHVTNAFSDSDSASVEEGGADADADVEALRRLSDNLAAA FRSPEDFAFLADARIAVPGGGGGGGDLLVHRCVLSARSPFLRGVFARRAAAAAGGGGE DGGERLELRELLGGGGEEVEVGYEALRLVLDYLYSGRVGDLPKAACLCVDEDCAHVGC HPAVAFMAQVLFAASTFQVAELTNLFQRRLLDVLDKVEVDNLLLILSVANLCNKSCMK LLERCLDMVVRSNLDMITLEKSLPPDVIKQIIDARLSLGLISPENKGFPNKHVRRIHR ALDSDDVELVRMLLTEGQTNLDDAFALHYAVEHCDSKITTELLDLALADVNHRNPRGY TVLHIAARRREPKIIVSLLTKGARPADVTFDGRKAVQISKRLTKQGDYFGVTEEGKPS PKDRLCIEILEQAERRDPQLGEASVSLAMAGESLRGRLLYLENRVALARIMFPMEARV AMDIAQVDGTLEFNLGSGANPPPERQRTTVDLNESPFIMKEEHLARMTALSKTVELGK RFFPRCSNVLDKIMDDETDPVSLGRDTSAEKRKRFHDLQDVLQKAFHEDKEENDRSGL SSSSSSTSIGAIRPRR</aaseq>

Gene Sequence

<dnaseqindica>4091..4329#3328..3528#2372..3119#90..650#gaggcctcctcctcgcctcgcctcgccacgccgcgccgcgacgcgacgcgccgtggtcagctggtcgccggtgcgggtgcgggtgcgcaatggagccgccgaccagccacgtcaccaacgcgttctccgactcggacagcgcgtccgtggaggaggggggcgccgacgcggacgccgacgtggaggcgctccgccgcctctccgacaacctcgccgcggcgttccgctcgcccgaggacttcgcgttcctcgccgacgcgcgcatcgccgtcccgggcggcggcggcggcggcggcgacctgctggtgcaccgctgcgtgctctccgcgcggagccccttcctgcgcggcgtcttcgcgcgccgcgccgccgccgccgcaggcggcggcggcgaggatggcggcgagaggctggagctccgggaactcctcggcggcggcggcgaggaggtggaggtcgggtacgaggcgctgcggctggtgctcgactacctctacagcggccgcgtcggcgacctgcccaaggcggcgtgcctctgcgtcgacgaggactgcgcccacgtcgggtgccaccccgccgtcgcgttcatggcgcaggtcctcttcgccgcctccaccttccaggtcgccgagctcaccaacctcttccaggtccgcctcttcgcagctgcctctccttttccccttccattcgcgatgctcatgtcatgccagttcatctcttccctgtgcttgcttggatgcgtattgctcatagaagtgggggtttaaagatgcatttttttagttgcgcgcgtggagctttgctttaggcggcaaaatgaactacttctgaaggagaggggagatggtctgaactgaatcactcctaatcacgttaatcattgcaatttggattactgcaattggaggcctgtgataattgcattgtgattaacttgctgtcatattggcgatgaacagtattcaggtttagttgtttgcgattttggggattcacgtgtgcttggtgctgtatgcattgcagagaaaaacaaaagcttacagttgtatgaacgtgtggatgcgactccctgcttcaattagaaatcgtccaaaaagctagtacatcttaagccattaatcaactcagatcatgcactgttacatcggttatgtttgatccaatcctcctaatcagtttattctaatgtctgaatcgaactgcctggctaactgtccttatctaacatgttgctgcttactgatcttgggggtgcttgccgttctcgttgttatttatcggattcttcttggtcatgttgacgcgaaaatggaagttaactgtgtttgatatccagcaagagtggtgctgatatagtaaaggtgtttcttaaccttttcttttcttgcaaaagagcagttccttattgaagtatcttcagataaggcgattggactgtgcaccatcctattctaggctgcttcaagtacacatgtttcactcaattgtaccatgatagggacatactcacataccgcacattatccttccaaatttgtcaatgctgcattaatgtgacagtgatatttatgcacagaaagcacaatcatatgttttccacttaaacttgactgtatctcagtgtttttaaattgaaatgtcacacatattcgaagcaataataaacgaacaacaaaaaaaatatgcatgtatcttatggtaaaatttgccttggctatattacagggggaaaatgagtggctacactccaatcacagcatgtttatccaagaacacaaaaggaaatttcaaaattttaaatgtaaaagcctaaggtcactaatgtttatatatatatcaacttttattctctttacagtctttggaagttgtttttaggagttatgggggttgtttttcagtaattctgtctcaaaattatattgcttgcgtggctgcgccatacgtgccaatctgacaagaaccaaacatgattgtactaattgtatatatagcctagcttcctttggtccaattgatggccctcagccttgtatttatatttataaatcttctggcgttaacattactctacattgaacttgctatttcaagtattatgttggtgtttggcttgtaatattttggtttctaaaaagaattaaaaccaggaagtttccttttctaataaaaaatgggccttgatgctacttgcttttgttgacctttgttttagaacgtggtactgtttttttcagataaggctgttccatactgaatccattaattattgctagcccaatgcatgtcagtcggttatcgtttgtaatgtttcactattttaagaagccagaaccaaagcaatgatatattcttctttttcatgcagcggcgtctccttgatgtccttgataaggttgaggtagataaccttctattgatcttatctgttgccaacttatgcaacaaatcttgcatgaaactgcttgaaagatgccttgatatggtagtccggtcaaaccttgacatgattactcttgagaagtcattgcctccagatgttatcaagcagattattgatgcacgcctaagcctcggattaatttcaccagaaaacaagggatttcctaacaaacatgtgaggaggatacacagagcccttgactctgacgatgtagagctagtcaggatgctgctcactgaaggacagacaaatcttgatgatgcgtttgcactgcactacgccgtcgaacattgtgactccaaaattacaaccgagcttttggatctcgcacttgcagatgttaatcatagaaacccaagaggttatactgttcttcacattgctgcgaggcgaagagagcctaaaatcattgtctcccttttaaccaagggggctcggccagcagatgttacattcgatgggagaaaagcggttcaaatctcaaaaagactaacaaaacaaggggattactttggggttaccgaagaaggaaaaccttctccaaaagataggttatgtattgaaatactggagcaagctgaaagaagggacccacaactcggagaagcatcagtttctcttgcaatggcaggtgagagtctacgaggaaggttgctgtatcttgaaaaccgaggtaaccttcacatatatcataatgggttcataatgctggtttctttggaattaactgtttttggtcttggcaacaaaaggaaggttacatttcagtttagtgtgtttcatgcagagtgcagtttcaagagtttcccagtgcccattttttagaacttccattttgttatgaagttgtatcttgatattatagtttttgtacgatgtagttgctttggcgaggattatgtttccgatggaggcaagagtagcaatggatattgctcaagtggatggaactttggaatttaacctgggttctggtgcaaatccacctcctgaaagacaacggacaactgttgatctaaatgaaagtcctttcataatgaaagaagaacacttagctcggatgacggcactctccaaaacaggtaatacacggcactctgtttattcacactgcctccaagcgatgtatattttgaatctaatgctacaaacttgtgtggcacactgctacacatgcaaatatttttgatttttcatattttctgatggaagctaaaactatagatgctcccattttgactgataggttcactgttgaataccctgagaggtttatgcaatgttgcatatcttttagctctaacactgtcaatgtgaaccatggacaattttgctcttttttgttcattcagaatgatagttcatactacctgaagattaaataattgacaaagatatgtacactttactgtggtaatttctaattttaatctggtcttgaataggtagcctagttaatctttcttggggtgcatgtgttgtctatagacttttgtggttgaaaaatctttgtacatcaagagcacagaatatacttaggtatatctataggaacaactgcttgagattcatcacagaagttgcaaagacattacattctcttaattggacatagactaattgcaagctgaatgtgtataccagtggagctcgggaaacgctttttcccgcgatgttcgaacgtgctcgacaagatcatggatgatgaaactgatccggtttccctcggaagagacacgtccgcggagaagaggaagaggtttcatgacctgcaggatgttcttcagaaggcattccacgaggacaaggaggagaatgacaggtcggggctctcgtcgtcgtcgtcatcgacatcgatcggggccattcgaccaaggagatgaacaccattgctcccaaatagttgccatattgatagctaactgtcctcctggagctactcacctgatggttgccttctgtcaattgccccccaaatatattctcaatggtttaggcttgtacagtattagttcttacagctattgccccgtcaattgtgaaacgcagaagtttcactagtgcttgtactcgaggtgtaatacaagtgcttgaattttgagttgtacttggaatttccagtggtttgctcgtaaaaatgagatgatttcttggctccc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0194300, RefSeq:Os01g0194300