Difference between revisions of "Atp6"
Xizanghanzi (talk | contribs) (→Function) |
Xizanghanzi (talk | contribs) (→Expression) |
||
| Line 6: | Line 6: | ||
===Expression=== | ===Expression=== | ||
| − | + | The calculated molecular weight of atp6 gene encoding protein is 6.578kDa, and it is rice mitochondrial ATP synthase 6kDa subunit, the predicted intracellular localization sites is in mitochondrial intermembrane space. Under various stresses, the expression of atp6 gene is up-regulated, Zhang et al. find the expression of atp6 gene in Arabidopsis suspension-cultured cells is induced by several abiotic stresses from salts, drought, and cold. Besides, under the carbonate stress, the atp6 gene is expressed in rice leaves and roots<ref name="ref3"/>. On the other hand, Sweetlove et al. find that atp6 gene expression is decreased by the oxidants H2O2 and Paraquat<ref name="ref4"/>. | |
===Evolution=== | ===Evolution=== | ||
Revision as of 12:08, 5 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
ATP synthase consists of two distinct parts, a hydrophilic F1 part which contains the nucleotide-binding site and catalyzes ATP hydrolysis, and a hydrophobic F0 part which channels protons through the membrane. atp6 is a unit of F0 and coded by atp6 gene. Besides, the atp6 gene is encoded in mitochondrial genome, and has about 1000 base pairs. Most researches show atp6 gene is related to male sterility--Plants that fail to produce fertile pollen grains. The CMS phenotype has been related to a homologous recombination hotspot domain in the atp6 gene, with a conserved sequence of 7 base pair 5’-TTCCCTC-3’ which can induce the formation of chimeric gene in mitochondrial DNA[1]. In rice, the [BO] type of CMS has been shown to be associated with an additional chimeric gene urfrmc which consists of the 5’ flanking noncoding region of atp6. Akagi et al. report that recombination events around some mitochondrial genes specially atp6, are involved in causing male sterility in Chinsurah BoroII type of CMS in rice[2]. What’s more, the function of atp6 gene is probably related to several abiotic stresses from salts, drought, and cold. Zhang et al. find that over-expression of atp6 gene in rice increases the resistance to carbonate stress, and over-expression of atp6 gene in transgenic yeast and Arabidopsis plants increased the resistance to salts, drought, oxidative and cold stresses[3].
Expression
The calculated molecular weight of atp6 gene encoding protein is 6.578kDa, and it is rice mitochondrial ATP synthase 6kDa subunit, the predicted intracellular localization sites is in mitochondrial intermembrane space. Under various stresses, the expression of atp6 gene is up-regulated, Zhang et al. find the expression of atp6 gene in Arabidopsis suspension-cultured cells is induced by several abiotic stresses from salts, drought, and cold. Besides, under the carbonate stress, the atp6 gene is expressed in rice leaves and roots[3]. On the other hand, Sweetlove et al. find that atp6 gene expression is decreased by the oxidants H2O2 and Paraquat[4].
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
atp6 |
|---|---|
| Description |
ATP synthase F0 subunit 6 |
| Version |
GeneID:6450195 |
| Length |
1005 bp |
| Definition |
Oryza sativa Japonica Group atp6, Mitochondrion gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Mitochondrion:225271..226275 |
| Sequence Coding Region |
225271..226275 |
| Genome Context |
<gbrowseImage1> name=NC_011033:225271..226275 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage1> |
| Gene Structure (RNA Editing) |
<gbrowseImage2> name=NC_011033:225271..226275 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage2> |
| Protein Sequence |
<aaseq>MNFDYNHVVIMGLNQRDSIWKLLNDYNVNSLKRRRQAEIDAFFEPFERAQRIRFNNWQNGIELLDGAEWRNGDIVIPGGGGPVISSPLDQFFIDPLFGLDMGNFYLSFTNESLFMAVTVVLVLSLFGVVTKKGGGKLVPNAWQSLVELIYDFVLNLVNEQIGGNVKQKFFPCILVTFTFSLFCNLQGMIPFSFTVTSHFLITLALSFSIFIGITIVGFQRHGLHFFSFLLPAGVPLPLAPFLVLLELISYCFRALSLGIRLFANMMAGHSLVKILSGFAWTMLFLNNIFYFIGDLGPLFIVLALTGLELGVAILQAYVFTILICIYLNDAINLH</aaseq> |
| Gene Sequence |
<dnaseqindica>1..1005#atgaatttcgatcacaatcatgtggtaataatgggtttgaatcagagagactcgatctggaaactcctcaatgattataacgtgaactcgttgaagagaaggagacaagcagaaatagacgctttttttgaaccatttgagagggcgcagcgtatccgtttcaataactggcagaacggaatagagttgttagatggggctgaatggaggaacggcgatatagttatccctggaggcggcggaccagtaatttcaagccccttggatcaatttttcattgatccattatttggtcttgatatgggtaacttttatttatcattcacaaatgaatccttgtctatggcggtaactgtcgttttggtgccatctttatttggagttgttacgaaaaagggcgggggaaagtcagtgccaaatgcatggcaatccttggtagagcttatttatgatttcgtgctgaacctggtaaacgaacaaataggtggaaatgttaaacaaaagtttttccctcgcatctcggtcacttttactttttcgttatttcgtaatccccagggtatgataccctttagcttcacagtgacaagtcattttctcattactttggctctttcattttccatttttataggcattacgatcgttggatttcaaagacatgggcttcatttttttagcttcttattaccagcgggagtcccactgccattagcaccttttttagtactccttgagctaatctctcattgttttcgtgcattaagctcaggaatacgtttatttgctaatatgatggccggtcatagttcagtaaagattttaagtgggttcgcttggactatgctatttctgaataatattttctatttcataggagatcttggtcccttatttatagttctagcattaaccggtctggaattaggtgtagctatattacaagctcatgtttctacgatctcaatttgtatttacttgaatgatgctataaatctccatcaa</dnaseqindica> |
| External Link(s) |
- ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref1 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref2 - ↑ 3.0 3.1 Cite error: Invalid
<ref>tag; no text was provided for refs namedref3 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref4