Difference between revisions of "Os11g0235200"

From RiceWiki
Jump to: navigation, search
(Function)
(Expression)
Line 6: Line 6:
  
 
===Expression===
 
===Expression===
sp1-2 is one TOS17 insertion mutant. The sp1 mutant plant showed a slight reduction in plant height, owing to the shorted panicle . In comparison with the wild type, the mature panicle length of Sp1-2 was strikingly reduced. Moreover, the seed size of the sp1-2 mutant was smaller than the wild type. In consisted with the smaller seeds, the weight of 1000 seeds was lower of the sp1-2 mutant compared to the wild type (Fig 1d). These results indicated that the SP1 affects not only the panicle size, but also the grain size.
+
[[File:SP1图1.png|right|thumb|250px|Figure1. Phenotype of the ''sp1-2'' mutant. (from reference<ref name="ref1" />)]]
 +
''sp1-2'' is one TOS17 insertion mutant. <br>
 +
'''(1) Phenotypic comparison between wild-type and ''sp1-2'' plants after heading.''' <br>
 +
The ''sp1-2'' mutant plant showed a slight reduction in plant height, owing to the shorted panicle (Figure 1a). <br>
 +
'''(2) Comparison of panicle sizes between the wild-type and ''sp1-2'' plants at the grain filling stage.''' <br>
 +
In comparison with the wild type, the mature panicle length of ''sp1-2'' was strikingly reduced (Figure 1b). <br>
 +
'''(3) Comparison of mature grains size between the wild type and ''sp1-2''.''' <br>
 +
The seed size of the ''sp1-2'' mutant was smaller than the wild type (Figure 1c). <br>
 +
'''(4) Comparison of mature grains weight between the wild type and ''sp1-2''.'''<br>
 +
In consisted with the smaller seeds, the weight of 1000 seeds was lower of the ''sp1-2'' mutant compared to the wild type (Figure 1d). <br>
 +
These results indicated that the ''SP1'' affects not only the panicle size, but also the grain size.
  
 
===Evolution===
 
===Evolution===

Revision as of 12:08, 5 June 2014

SP1 encodes a putative transporter that belongs to the peptide transporter (PTR) family,and regulates panicle development and seed size in rice.

Annotated Information

Function

SP1 encodes a putative transporter that belongs to the peptide transporter (PTR) family. SP1 is preferentially expressed in young panicle,especially in the phloem of the branches of young panicle.SP1 regulates panicle development and seed size in rice.

Expression

Figure1. Phenotype of the sp1-2 mutant. (from reference[1])

sp1-2 is one TOS17 insertion mutant.
(1) Phenotypic comparison between wild-type and sp1-2 plants after heading.
The sp1-2 mutant plant showed a slight reduction in plant height, owing to the shorted panicle (Figure 1a).
(2) Comparison of panicle sizes between the wild-type and sp1-2 plants at the grain filling stage.
In comparison with the wild type, the mature panicle length of sp1-2 was strikingly reduced (Figure 1b).
(3) Comparison of mature grains size between the wild type and sp1-2.
The seed size of the sp1-2 mutant was smaller than the wild type (Figure 1c).
(4) Comparison of mature grains weight between the wild type and sp1-2.
In consisted with the smaller seeds, the weight of 1000 seeds was lower of the sp1-2 mutant compared to the wild type (Figure 1d).
These results indicated that the SP1 affects not only the panicle size, but also the grain size.

Evolution

Phylogenetic analysis showed that the SP1 gene is classified into a distinct clade for nitrate transporters, and is closest to AtNRT1:2, an Arabidopsis nitrate transporter

Labs working on this gene

  • State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China,
  • State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences,Hangzhou 310006, China,
  • Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi, Bunkyo, Tokyo 113-8652, Japan,
  • Research Institute for Bioresources, Okayama University, 2-20-1, Chuo, Kurashiki, Okayama 710-0046, Japan

References

Please input cited references here.

Structured Information

Gene Name

Os11g0235200

Description

TGF-beta receptor, type I/II extracellular region family protein

Version

NM_001074096.1 GI:115484840 GeneID:4350145

Length

5257 bp

Definition

Oryza sativa Japonica Group Os11g0235200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 11

Location

Chromosome 11:7176158..7181414

Sequence Coding Region

7176608..7177532,7177841..7177965,7179701..7180180,7180759..7180976,7181105..7181243

Expression

GEO Profiles:Os11g0235200

Genome Context

<gbrowseImage1> name=NC_008404:7176158..7181414 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008404:7176158..7181414 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>gctaatatggatgttgagtcaaggcaaggccccaagggtggtgacaccatggctgcctccgaggtctccgtggactggaggggcaggccttgcggctctcgcaagcatggcggcatgaaagcggccgtctttgtgctagggatccaggcgttcgagatgatggcgatcgcggcggtggggaacaacctgatcacctacgtcttcaacgagatgcactacccgctgtcaaagtcggccaacatcgtgaccaacttcattggcaccgtcttcctcctctccctcctcggtggcttcctctccgactcctacctcggaagcttctggaccatgctcatcttcggcttcgtcgagctctccgggttcatactgctggccgtgcaggcgcacctgccgcagctgcggccgccggcgtgcgacatgatggcggcggcggcggcggaggggggatgcgaggaggcgagcggggtgaaggcggggatcttcttcgcggcgctgtacctggtggcgctggggagcgggtgcctcaagcccaacatcatcgcgcacggcgccgaccagttccggcgcggcggcggcggcggcggcgacggcgatggcgacgatggcggcgacgggaagcggctgtcgagctacttcaacgcggcctacttcagcttctgcgtgggggagctggtggcgctgacggtgctggtgtgggtgcagacgaggtcggggatggacgtggggttcggggtgtcggcggccgccatggccgtggggctggtcagcctcgtcgccggcgtcttcttctaccggaacaagccgccgcagggcagcatcttcatgcccatcgccaaggttttcgtcgcggcggtaaccaagaggaaacaagtgtgcccatcatcatcgtcgacgacagccgcctcgcatgctgtgatccccgccaccggtgccgcccctgtccaccgcatcaacaaattcaggttcttggacaaggcgtgcgtgaaggttcaggacggccatggcggcggcggcgacggggggaaggagagcgtgtggccgccgtgcacgccggcggaggtggagcaggtgaaggtgctactgtgcgtggtgcccatcttcgcgtgcaccatcgtcttcaacaccatcctggcgcagctgcagacgttctccgtgcagcagggctccgccatggacacccgcatcggcggcggcggcggcggcgccgccttccacatcccgccggcgtcgctgcaggccatcccctacctcgtcctcatcgcgctggtgccggcgtacgaggcgtgcttcgtgccggccatgcgccgcgccacgggcgtggacaccggcatcaccccgctccagcggatcggggtcggcctcttcgccgtcaccttctccatggtcgccgccgcgctcgtcgaggcacaccgccgccgccacgccggcgacgggctcctctccatcttctggatcgcgccgcagttcctggtgttcggcgtgtccgagatgttcaccgccgtggggctcatcgagttcttctacaagcagtcgctctccggcatgcaggccttcctcacctcaatgacctactgctcctactccttcggcttctacctcagctccctcctcgtctcgctcgtcaacaaggtcacctcgggcgacggcgccggcgccggcggcggcggctggctcagcgacaacgacctcaacaaggacaggctcgacctcttctactggctcctcgccgggctcagcctcctcaacttcttcaactacctcttctggtcgaggtggtactccaagagtgtggagacgaccgtgcaggtcgccggagttggaggagaaggcggcggcggcgagcagcaggaggagaagggtgttgacgaggtcaacatgggtcactga</cdnaseq>

Protein Sequence

<aaseq>ANMDVESRQGPKGGDTMAASEVSVDWRGRPCGSRKHGGMKAAVF VLGIQAFEMMAIAAVGNNLITYVFNEMHYPLSKSANIVTNFIGTVFLLSLLGGFLSDS YLGSFWTMLIFGFVELSGFILLAVQAHLPQLRPPACDMMAAAAAEGGCEEASGVKAGI FFAALYLVALGSGCLKPNIIAHGADQFRRGGGGGGDGDGDDGGDGKRLSSYFNAAYFS FCVGELVALTVLVWVQTRSGMDVGFGVSAAAMAVGLVSLVAGVFFYRNKPPQGSIFMP IAKVFVAAVTKRKQVCPSSSSTTAASHAVIPATGAAPVHRINKFRFLDKACVKVQDGH GGGGDGGKESVWPPCTPAEVEQVKVLLCVVPIFACTIVFNTILAQLQTFSVQQGSAMD TRIGGGGGGAAFHIPPASLQAIPYLVLIALVPAYEACFVPAMRRATGVDTGITPLQRI GVGLFAVTFSMVAAALVEAHRRRHAGDGLLSIFWIAPQFLVFGVSEMFTAVGLIEFFY KQSLSGMQAFLTSMTYCSYSFGFYLSSLLVSLVNKVTSGDGAGAGGGGWLSDNDLNKD RLDLFYWLLAGLSLLNFFNYLFWSRWYSKSVETTVQVAGVGGEGGGGEQQEEKGVDEV NMGH</aaseq>

Gene Sequence

<dnaseqindica>3883..4807#3450..3574#1235..1714#439..656#172..310#gcctgaccacacaagcacaaagcaagcactatcaccaaaaggatcagagaagaaactgatatcactatctgatcagtgtagcattgcagcctctcttcttggtaggagtgagctagcacagtgaagagctaattaagccatttgtgtgagcttgcgttgagtgagctctgagctaatatggatgttgagtcaaggcaaggccccaagggtggtgacaccatggctgcctccgaggtctccgtggactggaggggcaggccttgcggctctcgcaagcatggcggcatgaaagcggccgtctttgtgctaggttcgtttaattagttagttactctcttaatccattatttcttgggtagaaatatgttgcttgatctgatttgttcttgtttgtgtttgtgttttgttggatatcgtttgcattgatgatgattgcagggatccaggcgttcgagatgatggcgatcgcggcggtggggaacaacctgatcacctacgtcttcaacgagatgcactacccgctgtcaaagtcggccaacatcgtgaccaacttcattggcaccgtcttcctcctctccctcctcggtggcttcctctccgactcctacctcggaagcttctggaccatgctcatcttcggcttcgtcgagctctccgtaagaaattgattcatccatccttcatcgtcgatctcttctctttgatatcgcactacgataaaattgacattctttacacctagatgcaactttttgggtccttttttagactgcatttcttggctccttgcaagcaagaacagctgaacaggatcggatcttgtttgtttgtttgtttaatcatgtagggatgttgtttctaggtaggattatatataaaattaaccagataagacacgcgaaagattcagcgactgttcatcgtgccgcgaaaatgatgaggttttgaggaggaggcagcaagttcagcgtaaaggtgagagagagagtggaagaaaatcatggctgcctccatccaatgcggccatgctagctagtgcgccgcccaaaacgccactcgactccacaatatcatttcttggcttttgattttaattttcgagcaggttcattgcatcccatcccatgaccatatccatggcgataattaaccattactgattaatgcgccgccaactttagttagtttagctaataatttttgttgtttttttatttctaatttttcttggcaggggttcatactgctggccgtgcaggcgcacctgccgcagctgcggccgccggcgtgcgacatgatggcggcggcggcggcggaggggggatgcgaggaggcgagcggggtgaaggcggggatcttcttcgcggcgctgtacctggtggcgctggggagcgggtgcctcaagcccaacatcatcgcgcacggcgccgaccagttccggcgcggcggcggcggcggcggcgacggcgatggcgacgatggcggcgacgggaagcggctgtcgagctacttcaacgcggcctacttcagcttctgcgtgggggagctggtggcgctgacggtgctggtgtgggtgcagacgaggtcggggatggacgtggggttcggggtgtcggcggccgccatggccgtggggctggtcagcctcgtcgccggcgtcttcttctaccggaacaagccgccgcagggcagcatcttcatgcccatcgccaaggtacgtacgttatgccgtacaatacaatcgtcgtacgtgtacggttcgtcatgtacttttatacgctttcttcttttttttttttagagaaaaatatttcttacccggcctctacatccaatcagatatatgcagactttttaaattagaaacttaactctcaaacaatctaatctgaaacttgctactacgattaaactctagatctttaggatacgcttaggacattgcaaccacaattgcatcttcttttcttttctagttggcacattgaaatatcttttgatataattttgacagccatcttttttttaaatgaactctctgtttctaaaatataataacatagtattccattccatgtaacctagtactacgaatctatgtttaattgaactatgaatttagtagatttatagtactgtgttggtgtctattctagtactacgaatttatctcattctgttttagcatcttatattttaggagaggtaggattatttttaatcggacggagtatacaagttggaaacaaatactacatcattgtgttgcatttgcaaaagcagagccaaccaactctgtttttgtgccagctactatattcccctaaaaatattgttgcattcataaatattggaggtcaattttaagctaggtctatgttctctgttcctgcatatggtagttacttgaaaaatcctgaaaatatgataacgtgcattatggtgccatctgtcgctacacaaatatatagtaatatataagtataaaggttagagaaaacatggccgtgggccctagcaatgcgtttctgcactagctaaatagaatatatataatatgtgacaagactaattaatattaagaagcaccataggtagatcaaatttaaaaatgtaaggatgaaaaggcatgtgtatgtacaacaaattaaacaacagaaagtttgaccatacgtatcatcctgattccttgtttggaaagtactactccagatacgctgcttttatatactagtataaaagcaaaaccgcctattttcgttaaatataatgcataatctttatttgatccaaaaaagctacatgatcaaacaggagtttggtacagggactattttatcctcatagtcacctcgtgcactaccacataaaaagcacacgagatcatgggtttacaaccgtttctacattaaacaaaatgaaatgctacctagtttattgccaaatgaagtatttagtcaataaaggaaaagaaagcatatatatgatttactgaatgagataataatgtatatgtatgttgggataaaaaaaataaaactgatgattttaagttacacactggctggcctcctctgccttttctttcttctttctgggacaagttgacaagggctagtggctcagctttatttctctcttttgtgtgggtcaagaattaccactgtctgctgggaggtacctttgattattgatcacagaaatggaggcccattctgttatgcttgtgatacatcaatcatgtttgcatgtgtggggagagacatgtaacatgactgacaatgatctcaggacagcatatatatctttccagcttaattttgtttttagttcttgacttagatcggtataaaccccctaaaactcaattgcacgtgaaaataacaaactctcactcgatcgctgacattttgagctgatggtcggtacatgtgactcaatatgtataggttttcgtcgcggcggtaaccaagaggaaacaagtgtgcccatcatcatcgtcgacgacagccgcctcgcatgctgtgatccccgccaccggtgccgcccctgtccaccgcatcaacaaattcaggtaggtaaaaaaatatttgtaagtggcactgtaatatactacttatttttaaaaaatatatggcaccgttaacttttcgcataatgtttgaccattcgtcttattcaaaaatttaatattaattcataaaaatataagttaagattatattttatttgataataaaacaagtcacaacaagataaaaataaaatttatataatttttttaataagattaatagataaatattatgccaaaagtcaaatggcgtgatatatttcgaaggagtataatagtttactcatttcatgtatgcatgcttacaggttcttggacaaggcgtgcgtgaaggttcaggacggccatggcggcggcggcgacggggggaaggagagcgtgtggccgccgtgcacgccggcggaggtggagcaggtgaaggtgctactgtgcgtggtgcccatcttcgcgtgcaccatcgtcttcaacaccatcctggcgcagctgcagacgttctccgtgcagcagggctccgccatggacacccgcatcggcggcggcggcggcggcgccgccttccacatcccgccggcgtcgctgcaggccatcccctacctcgtcctcatcgcgctggtgccggcgtacgaggcgtgcttcgtgccggccatgcgccgcgccacgggcgtggacaccggcatcaccccgctccagcggatcggggtcggcctcttcgccgtcaccttctccatggtcgccgccgcgctcgtcgaggcacaccgccgccgccacgccggcgacgggctcctctccatcttctggatcgcgccgcagttcctggtgttcggcgtgtccgagatgttcaccgccgtggggctcatcgagttcttctacaagcagtcgctctccggcatgcaggccttcctcacctcaatgacctactgctcctactccttcggcttctacctcagctccctcctcgtctcgctcgtcaacaaggtcacctcgggcgacggcgccggcgccggcggcggcggctggctcagcgacaacgacctcaacaaggacaggctcgacctcttctactggctcctcgccgggctcagcctcctcaacttcttcaactacctcttctggtcgaggtggtactccaagagtgtggagacgaccgtgcaggtcgccggagttggaggagaaggcggcggcggcgagcagcaggaggagaagggtgttgacgaggtcaacatgggtcactgacatgtgggttcgaaccgcacgtctagtatattaggtggattattaatcatttaacctagtcttaaccttttttttatggtttttccttgtatggaaaaatattagtaagggtggatgtatatgagtccccacctaattaaggagagtgtgtgtgatgtataaattaattaatcaaaagggattaggtgattattacttagtaatgatccctgattaggtcaagtcaaaaggtagtagttctgagtttgactctgcaaggatgcaagagtagtggtatttgggtagggatcaagtgatcaagtacgtatctagtccttttctttaatgataaggagctagtatatatctatgtactttatatatgtagctatcatgtaaatgacaaaaggatttgccataaaagcaaagtactgataatagttggtgcaaaaaatactttcactgttgatc</dnaseqindica>

External Link(s)

NCBI Gene:Os11g0235200, RefSeq:Os11g0235200

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1