Difference between revisions of "Atp6"

From RiceWiki
Jump to: navigation, search
(→‎References)
(→‎References)
Line 16: Line 16:
 
==References==
 
==References==
 
[1]Ramin Hosseini. The possible role of atp6 gene in cytoplasmic male sterility in WA (Wild Abortive) type of rice (Oryza sativa L.). Iranian Journal of Biotechnology. 2010(8):117-120.
 
[1]Ramin Hosseini. The possible role of atp6 gene in cytoplasmic male sterility in WA (Wild Abortive) type of rice (Oryza sativa L.). Iranian Journal of Biotechnology. 2010(8):117-120.
 +
</ref>
 
[2]Akagi H, Sakamoto M, Shinjyo C, Shima da H, Fujimara T. A unique sequence located downstream from the rice mitochondrial atp6 may cause male sterility. Curr Genet.1994(25):52-58.
 
[2]Akagi H, Sakamoto M, Shinjyo C, Shima da H, Fujimara T. A unique sequence located downstream from the rice mitochondrial atp6 may cause male sterility. Curr Genet.1994(25):52-58.
 +
</ref>
 
[3]Xinxin Zhang, Shenkui Liu, Tetsuo Takano. Overexpression of a mitochondrial ATP synthase small subunit gene (AtMtATP6) confers tolerance to several abiotic stresses in Saccharomyces cerevisiae and Arabidopsis thaliana. Biotechnol Lett[J].2008(30):1289-1294.
 
[3]Xinxin Zhang, Shenkui Liu, Tetsuo Takano. Overexpression of a mitochondrial ATP synthase small subunit gene (AtMtATP6) confers tolerance to several abiotic stresses in Saccharomyces cerevisiae and Arabidopsis thaliana. Biotechnol Lett[J].2008(30):1289-1294.
 +
</ref>
 
[4]Sweetlove L J, Heazlewood J L, Herald V, Holtzapffel R, Day D A, Leaver C J, Millar A H. The impact of oxidative stress on Arabidopsis mitochondria. Plant J. 2002(32):891-904.
 
[4]Sweetlove L J, Heazlewood J L, Herald V, Holtzapffel R, Day D A, Leaver C J, Millar A H. The impact of oxidative stress on Arabidopsis mitochondria. Plant J. 2002(32):891-904.
  

Revision as of 12:13, 5 June 2014

Please input one-sentence summary here.

Annotated Information

Function

ATP synthase consists of two distinct parts, a hydrophilic F1 part which contains the nucleotide-binding site and catalyzes ATP hydrolysis, and a hydrophobic F0 part which channels protons through the membrane. atp6 is a unit of F0 and coded by atp6 gene. Besides, the atp6 gene is encoded in mitochondrial genome, and has about 1000 base pairs. Most researches show atp6 gene is related to male sterility--Plants that fail to produce fertile pollen grains. The CMS phenotype has been related to a homologous recombination hotspot domain in the atp6 gene, with a conserved sequence of 7 base pair 5’-TTCCCTC-3’ which can induce the formation of chimeric gene in mitochondrial DNA[1]. In rice, the [BO] type of CMS has been shown to be associated with an additional chimeric gene urfrmc which consists of the 5’ flanking noncoding region of atp6. Akagi et al. report that recombination events around some mitochondrial genes specially atp6, are involved in causing male sterility in Chinsurah BoroII type of CMS in rice[2]. What’s more, the function of atp6 gene is probably related to several abiotic stresses from salts, drought, and cold. Zhang et al. find that over-expression of atp6 gene in rice increases the resistance to carbonate stress, and over-expression of atp6 gene in transgenic yeast and Arabidopsis plants increased the resistance to salts, drought, oxidative and cold stresses[3].

Expression

The calculated molecular weight of atp6 gene encoding protein is 6.578kDa, and it is rice mitochondrial ATP synthase 6kDa subunit, the predicted intracellular localization sites is in mitochondrial intermembrane space. Under various stresses, the expression of atp6 gene is up-regulated, Zhang et al. find the expression of atp6 gene in Arabidopsis suspension-cultured cells is induced by several abiotic stresses from salts, drought, and cold. Besides, under the carbonate stress, the atp6 gene is expressed in rice leaves and roots[3]. On the other hand, Sweetlove et al. find that atp6 gene expression is decreased by the oxidants H2O2 and Paraquat[4].

Evolution

The protein encoded by atp6 gene is a part of F0 of the mitochondrial ATP synthase. The amino acid sequences of this protein in rice share 84% and 72% amino acid identity with that of in Arabidopsis and potato[3].

Labs working on this gene

Please input related labs here.

References

[1]Ramin Hosseini. The possible role of atp6 gene in cytoplasmic male sterility in WA (Wild Abortive) type of rice (Oryza sativa L.). Iranian Journal of Biotechnology. 2010(8):117-120. </ref> [2]Akagi H, Sakamoto M, Shinjyo C, Shima da H, Fujimara T. A unique sequence located downstream from the rice mitochondrial atp6 may cause male sterility. Curr Genet.1994(25):52-58. </ref> [3]Xinxin Zhang, Shenkui Liu, Tetsuo Takano. Overexpression of a mitochondrial ATP synthase small subunit gene (AtMtATP6) confers tolerance to several abiotic stresses in Saccharomyces cerevisiae and Arabidopsis thaliana. Biotechnol Lett[J].2008(30):1289-1294. </ref> [4]Sweetlove L J, Heazlewood J L, Herald V, Holtzapffel R, Day D A, Leaver C J, Millar A H. The impact of oxidative stress on Arabidopsis mitochondria. Plant J. 2002(32):891-904.

Structured Information

Gene Name

atp6

Description

ATP synthase F0 subunit 6

Version

GeneID:6450195

Length

1005 bp

Definition

Oryza sativa Japonica Group atp6, Mitochondrion gene.

Source

Oryza sativa Japonica Group 

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Mitochondrion

Location

Mitochondrion:225271..226275

Sequence Coding Region

225271..226275

Genome Context

<gbrowseImage1> name=NC_011033:225271..226275 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage1>

Gene Structure
(RNA Editing)

<gbrowseImage2> name=NC_011033:225271..226275 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage2>

Protein Sequence

<aaseq>MNFDYNHVVIMGLNQRDSIWKLLNDYNVNSLKRRRQAEIDAFFEPFERAQRIRFNNWQNGIELLDGAEWRNGDIVIPGGGGPVISSPLDQFFIDPLFGLDMGNFYLSFTNESLFMAVTVVLVLSLFGVVTKKGGGKLVPNAWQSLVELIYDFVLNLVNEQIGGNVKQKFFPCILVTFTFSLFCNLQGMIPFSFTVTSHFLITLALSFSIFIGITIVGFQRHGLHFFSFLLPAGVPLPLAPFLVLLELISYCFRALSLGIRLFANMMAGHSLVKILSGFAWTMLFLNNIFYFIGDLGPLFIVLALTGLELGVAILQAYVFTILICIYLNDAINLH</aaseq>

Gene Sequence

<dnaseqindica>1..1005#atgaatttcgatcacaatcatgtggtaataatgggtttgaatcagagagactcgatctggaaactcctcaatgattataacgtgaactcgttgaagagaaggagacaagcagaaatagacgctttttttgaaccatttgagagggcgcagcgtatccgtttcaataactggcagaacggaatagagttgttagatggggctgaatggaggaacggcgatatagttatccctggaggcggcggaccagtaatttcaagccccttggatcaatttttcattgatccattatttggtcttgatatgggtaacttttatttatcattcacaaatgaatccttgtctatggcggtaactgtcgttttggtgccatctttatttggagttgttacgaaaaagggcgggggaaagtcagtgccaaatgcatggcaatccttggtagagcttatttatgatttcgtgctgaacctggtaaacgaacaaataggtggaaatgttaaacaaaagtttttccctcgcatctcggtcacttttactttttcgttatttcgtaatccccagggtatgataccctttagcttcacagtgacaagtcattttctcattactttggctctttcattttccatttttataggcattacgatcgttggatttcaaagacatgggcttcatttttttagcttcttattaccagcgggagtcccactgccattagcaccttttttagtactccttgagctaatctctcattgttttcgtgcattaagctcaggaatacgtttatttgctaatatgatggccggtcatagttcagtaaagattttaagtgggttcgcttggactatgctatttctgaataatattttctatttcataggagatcttggtcccttatttatagttctagcattaaccggtctggaattaggtgtagctatattacaagctcatgtttctacgatctcaatttgtatttacttgaatgatgctataaatctccatcaa</dnaseqindica>

External Link(s)

NCBI Gene:atp6

  1. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. ↑ 3.0 3.1 3.2 Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref4
Retrieved from "https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp6&oldid=178344"