Difference between revisions of "Os01g0197700"
(→Annotated Information) |
|||
| Line 5: | Line 5: | ||
[[File:Eeee.jpg|right|thumb|350px| '' | [[File:Eeee.jpg|right|thumb|350px| '' | ||
QTL analysis and molecular cloning. (A) Gross morphology of Koshihikari and Habataki at maturity.(D) Comparison of grain number in the main panicle of Koshihikari (Ko), Habataki (Ha), and 5150. (H) High-resolution linkage map of Gn1a. (I) OsCKX2 structure and mutation sites in Habataki (blue) and 5150 (red). (K) Comparison of grain number per main panicle in nontransgenic and transgenic lines. 2 copy CKX2, transgenic <ref name="ref1" />).'']] | QTL analysis and molecular cloning. (A) Gross morphology of Koshihikari and Habataki at maturity.(D) Comparison of grain number in the main panicle of Koshihikari (Ko), Habataki (Ha), and 5150. (H) High-resolution linkage map of Gn1a. (I) OsCKX2 structure and mutation sites in Habataki (blue) and 5150 (red). (K) Comparison of grain number per main panicle in nontransgenic and transgenic lines. 2 copy CKX2, transgenic <ref name="ref1" />).'']] | ||
| − | Transgenic plants carrying two copies of the sense strand of OsCKX2 that was highly expressed showed reduced grain numbers compared to TC65. However, transgenic plants with antisense strands of OsCKX2 that had reduced levels of expression developed higher grain numbers. | + | Expression level of OsCKX2 can influence the amount of phytohormone cytokinin,Reduced expression of OsCKX2 causes cytokinin accumulation in inflorescence meristems and increases the number of reproductive organs, resulting in enhanced grain yield.Transgenic plants carrying two copies of the sense strand of OsCKX2 that was highly expressed showed reduced grain numbers compared to TC65. However, transgenic plants with antisense strands of OsCKX2 that had reduced levels of expression developed higher grain numbers. |
OsCKX2 reduce CKX activity in Habataki, NIL-Gn1a, and 5150, and the increased production of CK conjugates to reduce the overall CK activity . | OsCKX2 reduce CKX activity in Habataki, NIL-Gn1a, and 5150, and the increased production of CK conjugates to reduce the overall CK activity . | ||
| Line 17: | Line 17: | ||
[[File:Dfghjj.png|left|thumb|150px| ''Expression profile of OsCKX2.'']] | [[File:Dfghjj.png|left|thumb|150px| ''Expression profile of OsCKX2.'']] | ||
transgenic rice harboring an OsCKX2 promoter::β-glucuronidase (GUS) construct. GUS expression was observed mainly in the vascular tissue in developing culms, inflorescence meristems, and young flowers in the T2 generation of transgenic plants . The expression of OsCKX2 in inflorescence meristems might regulate the CK level to control flower number. CK is known to be translocated acropetally via the xylem and systemically via the phloem . The high levels of expression in these tissues suggest that OsCKX2 plays a role in regulating CK levels in the vascular system of developing culms, where CK is transported to the inflorescence meristems<ref name="ref1" />. | transgenic rice harboring an OsCKX2 promoter::β-glucuronidase (GUS) construct. GUS expression was observed mainly in the vascular tissue in developing culms, inflorescence meristems, and young flowers in the T2 generation of transgenic plants . The expression of OsCKX2 in inflorescence meristems might regulate the CK level to control flower number. CK is known to be translocated acropetally via the xylem and systemically via the phloem . The high levels of expression in these tissues suggest that OsCKX2 plays a role in regulating CK levels in the vascular system of developing culms, where CK is transported to the inflorescence meristems<ref name="ref1" />. | ||
| − | + | The expression of OsCKX2 will directly influence the amount of cytokinin oxidase/dehydrogenase which degrades the phytohormone cytokinin, so the expression level of OsCKX2 will directly affect the Rice Grain Production by causeing cytokinin accumulation in inflorescence meristems and increases the number of reproductive organs. | |
| − | |||
===Evolution=== | ===Evolution=== | ||
[[File:Fggg.png|right|thumb|250px| ''Phylogenetic relationship of CKX proteins in rice and Arabidopsis.'']] | [[File:Fggg.png|right|thumb|250px| ''Phylogenetic relationship of CKX proteins in rice and Arabidopsis.'']] | ||
Phylogenetic relationship of CKX proteins in rice and Arabidopsis.<ref name="ref1" /> | Phylogenetic relationship of CKX proteins in rice and Arabidopsis.<ref name="ref1" /> | ||
| − | |||
==Labs working on this gene== | ==Labs working on this gene== | ||
Revision as of 12:38, 5 June 2014
Gn1a, is a gene for cytokinin oxidase/dehydrogenase (OsCKX2). Reduced expression of OsCKX2 causes cytokinin accumulation in inflorescence meristems and increases the number of reproductive organs, resulting in enhanced grain yield.
Contents
Annotated Information
Function
Expression level of OsCKX2 can influence the amount of phytohormone cytokinin,Reduced expression of OsCKX2 causes cytokinin accumulation in inflorescence meristems and increases the number of reproductive organs, resulting in enhanced grain yield.Transgenic plants carrying two copies of the sense strand of OsCKX2 that was highly expressed showed reduced grain numbers compared to TC65. However, transgenic plants with antisense strands of OsCKX2 that had reduced levels of expression developed higher grain numbers. OsCKX2 reduce CKX activity in Habataki, NIL-Gn1a, and 5150, and the increased production of CK conjugates to reduce the overall CK activity .
Protein Structure
The OsCKX2 of Koshihikari and Habataki consist of four exons and three introns and encode proteins of 565 or 563 amino acids, respectively. the region between 74 – 255 is FAD-binding PCMH-type domian. it has UDP-N-acetylmuramate dehydrogenase activity, cytokinin dehydrogenase activity and flavin adenine dinucleotide binding.[2]
Expression
transgenic rice harboring an OsCKX2 promoter::β-glucuronidase (GUS) construct. GUS expression was observed mainly in the vascular tissue in developing culms, inflorescence meristems, and young flowers in the T2 generation of transgenic plants . The expression of OsCKX2 in inflorescence meristems might regulate the CK level to control flower number. CK is known to be translocated acropetally via the xylem and systemically via the phloem . The high levels of expression in these tissues suggest that OsCKX2 plays a role in regulating CK levels in the vascular system of developing culms, where CK is transported to the inflorescence meristems[1]. The expression of OsCKX2 will directly influence the amount of cytokinin oxidase/dehydrogenase which degrades the phytohormone cytokinin, so the expression level of OsCKX2 will directly affect the Rice Grain Production by causeing cytokinin accumulation in inflorescence meristems and increases the number of reproductive organs.
Evolution
Phylogenetic relationship of CKX proteins in rice and Arabidopsis.[1]
Labs working on this gene
Please input related labs here.
References
- ↑ 1.0 1.1 1.2 Ashikari, M., Sakakibara, H., Lin, S., Yamamoto, T., Takashi, T., Nishimura, A., ... & Matsuoka, M. (2005). Cytokinin oxidase regulates rice grain production. Science, 309(5735), 741-745.
- ↑ http://www.uniprot.org/uniprot/Q4ADV8
Structured Information
| Gene Name |
Os01g0197700 |
|---|---|
| Description |
OsCKX2，cytokinin oxidase/dehydrogenase |
| Version |
AB205193.1 GI:71609872.(gene version=Gene ID: 4327334) |
| Length |
1698 bp |
| Definition |
Oryza sativa Japonica Group OsCKX2 mRNA for cytokinin oxidase/dehydrogenase, complete cds. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:5273310..5274501 |
| Sequence Coding Region |
1..625,717..1192 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:5273310..5274501 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:5273310..5274501 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgaagcaagagcaggtcaggatggcagtgctcctcatgctcaactgcttcgtcaaggccacggcgccgccgccatggccgccgtcggcttcgtccgcctccttcctcgacgacctcggcgacctcggcatcgcgccgctcatccgcgccgacgaggcgggcaccgcgcgcgcctccgccgactttggcaacctctccgtcgccggcgtcggggcgcctcggctcgccgccgccgccgccgtgctctacccgtcgcgccccgccgacatcgccgcgctgctgcgcgcgtcgtgcgcacgcccggcgccgttcgcggtgtccgcgcgggggtgtggccactcggtgcacggccaggcctccgcgcccgacggcgtcgtcgtcgacatggcgtcgctcggccgcctgcagggcggcggcgcgcggcgcctcgccgtgtcagtggaggggcggtacgtcgacgccggcggcgagcagctgtgggtggacgtgctgcgcgcgtccatggcgcacgggctcacgccggtgtcgtggacagactacctccacctcaccgtcggcggcacgctgtccaacgccggcatcagcggccaggccttccgccatggcccccagatttccaacgtgctagagctcgacgtcatcaccggtgtcggggagatggtgacgtgctcgaaggagaaggcgccggacctgttcgacgcggtgctgggcgggctggggcagttcggcgtcatcacgcgggcgcgcatcccgctcgcgccggcgccggcgagggcgcggtgggtgcggttcgtgtacacgacggcggcggcgatgacggccgaccaggagcgcctcatcgccgtcgatcgcgccggcggcgccggcgcggtgggcgggctgatggactacgtcgagggctcggtccacctgaaccagggcctggtcgagacctggcgcacgcagccgcagccgccttcgccgtcctcctcctcctcctcatccttcttctccgacgccgacgaggcccgcgtcgccgcgctcgccaaggaggccggcggcgtgctgtatttcctcgagggcgccatctacttcggcggcgccgccgggccgtccgccgccgacgttgacaagaggatggatgtgctgcgtcgcgagctgcggcacgagcgcgggttcgtgttcgcgcaggacgtggcgtacgccgggttcctggaccgcgtccacgacggcgagctcaagctccgcgccgcggggctctgggacgtgccgcacccatggctgaacctgttcctcccccgctccggcgtcctcgccttcgccgacggcgtcttccacggcatcctcagccgcacccccgccatgggccccgtcctcatctaccccatgaaccgcaacaagtgggacagtaacatgtcggcagtgatcaccgacgacgacggtgacgaggtgttctacacggtggggatcctgcggtcggcggcggcggccggcgacgtggggaggctggaggagcagaacgacgagatcttgggtttctgcgaggtggccgggatagcctacaagcagtacctgccttactacggcagccaggcagagtggcagaagcggcacttcggtgccaatctctggccaagattcgtgcagcggaagagcaagtatgatccaaaggccatcctgtcccgtggccaggggattttcacgtcaccactcgcatga</cdnaseq> |
| Protein Sequence |
<aaseq>MKQEQVRMAVLLMLNCFVKATAPPPWPPSASSASFLDDLGDLGI APLIRADEAGTARASADFGNLSVAGVGAPRLAAAAAVLYPSRPADIAALLRASCARPA
PFAVSARGCGHSVHGQASAPDGVVVDMASLGRLQGGGARRLAVSVEGRYVDAGGEQLW
VDVLRASMAHGLTPVSWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVLELDVITGVG
EMVTCSKEKAPDLFDAVLGGLGQFGVITRARIPLAPAPARARWVRFVYTTAAAMTADQ
ERLIAVDRAGGAGAVGGLMDYVEGSVHLNQGLVETWRTQPQPPSPSSSSSSSFFSDAD
EARVAALAKEAGGVLYFLEGAIYFGGAAGPSAADVDKRMDVLRRELRHERGFVFAQDV
AYAGFLDRVHDGELKLRAAGLWDVPHPWLNLFLPRSGVLAFADGVFHGILSRTPAMGP
VLIYPMNRNKWDSNMSAVITDDDGDEVFYTVGILRSAAAAGDVGRLEEQNDEILGFCE
VAGIAYKQYLPYYGSQAEWQKRHFGANLWPRFVQRKSKYDPKAILSRGQGIFTSPLA</aaseq>
|
| Gene Sequence |
<dnaseqindica>1..625#717..1192#ATGGCAGTGCTCCTCATGCTCAACTGCTTCGTCAAGGCCACGGCGCCGCCGCCATGGCCGCCGTCGGCTT CGTCCGCCTCCTTCCTCGACGACCTCGGCGACCTCGGCATCGCGCCGCTCATCCGCGCCGACGAGGCGGG CACCGCGCGCGCCTCCGCCGACTTTGGCAACCTCTCCGTCGCCGGCGTCGGGGCGCCTCGGCTCGCCGCC GCCGCCGCCGTGCTCTACCCGTCGCGCCCCGCCGACATCGCCGCGCTGCTGCGCGCGTCGTGCGCACGCC CGGCGCCGTTCGCGGTGTCCGCGCGGGGGTGTGGCCACTCGGTGCACGGCCAGGCCTCCGCGCCCGACGG CGTCGTCGTCGACATGGCGTCGCTCGGCCGCCTGCAGGGCGGCGGCGCGCGGCGCCTCGCCGTGTCAGTG GAGGGGCGGTACGTCGACGCCGGCGGCGAGCAGCTGTGGGTGGACGTGCTGCGCGCGTCCATGGCGCACG GGCTCACGCCGGTGTCGTGGACAGACTACCTCCACCTCACCGTCGGCGGCACGCTGTCCAACGCCGGCAT CAGCGGCCAGGCCTTCCGCCATGGCCCCCAGATTTCCAACGTGCTAGAGCTCGACGTCATCACCGGTACG TAGATCCATCACATCTACTAAGACACGCGCCGCCATGATCGAGGTAATTAAGGTATAGGTGTTTTGACGT ATACATGTATCTGCAGGTGTCGGGGAGATGGTGACGTGCTCGAAGGAGAAGGCGCCGGACCTGTTCGACG CGGTGCTGGGCGGGCTGGGGCAGTTCGGCGTCATCACGCGGGCGCGCATCCCGCTCGCGCCGGCGCCGGC GAGGGCGCGGTGGGTGCGGTTCGTGTACACGACGGCGGCGGCGATGACGGCCGACCAGGAGCGCCTCATC GCCGTCGATCGCGCCGGCGGCGCCGGCGCGGTGGGCGGGCTGATGGACTACGTCGAGGGCTCGGTCCACC TGAACCAGGGCCTGGTCGAGACCTGGCGCACGCAGCCGCAGCCGCCTTCGCCGTCCTCCTCCTCCTCCTC ATCCTTCTTCTCCGACGCCGACGAGGCCCGCGTCGCCGCGCTCGCCAAGGAGGCCGGCGGCGTGCTGTAT TTCCTCGAGGGCGCCATCTACTTCGGCGGCGCCGCCGGGCCGTCCGCCGCCGACGTTGACAAGGTATACT AG </dnaseqindica> |
| External Link(s) |
