Difference between revisions of "Os01g0197700"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(Expression)
Line 17: Line 17:
 
[[File:Dfghjj.png|left|thumb|150px| ''Expression profile of OsCKX2.'']]
 
[[File:Dfghjj.png|left|thumb|150px| ''Expression profile of OsCKX2.'']]
 
transgenic rice harboring an OsCKX2 promoter::β-glucuronidase (GUS) construct. GUS expression was observed mainly in the vascular tissue in developing culms, inflorescence meristems, and young flowers in the T2 generation of transgenic plants . The expression of OsCKX2 in inflorescence meristems might regulate the CK level to control flower number. CK is known to be translocated acropetally via the xylem and systemically via the phloem . The high levels of expression in these tissues suggest that OsCKX2 plays a role in regulating CK levels in the vascular system of developing culms, where CK is transported to the inflorescence meristems<ref name="ref1" />.
 
transgenic rice harboring an OsCKX2 promoter::β-glucuronidase (GUS) construct. GUS expression was observed mainly in the vascular tissue in developing culms, inflorescence meristems, and young flowers in the T2 generation of transgenic plants . The expression of OsCKX2 in inflorescence meristems might regulate the CK level to control flower number. CK is known to be translocated acropetally via the xylem and systemically via the phloem . The high levels of expression in these tissues suggest that OsCKX2 plays a role in regulating CK levels in the vascular system of developing culms, where CK is transported to the inflorescence meristems<ref name="ref1" />.
The expression of OsCKX2 will directly influence the amount of cytokinin oxidase/dehydrogenase which degrades the phytohormone cytokinin, so the expression level of OsCKX2 will directly affect the Rice Grain Production by causeing cytokinin accumulation in inflorescence meristems and increases the number of reproductive organs.
+
The expression of OsCKX2 will directly influence the amount of cytokinin oxidase/dehydrogenase which degrades the phytohormone cytokinin, so the expression level of OsCKX2 will directly affect the Rice Grain Production by causeing cytokinin accumulation in inflorescence meristems and increases the number of reproductive organs.The expression of OsCKX2 in inflorescence meristems might regulate the CK level to control flower number. CK is known to be translocated acropetally via the xylem and systemically via the phloem (35). The high levels of expression in these tissues suggest that OsCKX2 plays a role in regulating CK levels in the vascular system of developing culms, where CK is transported to the inflorescence meristems.
 +
 
 
===Evolution===
 
===Evolution===
 
  [[File:Fggg.png|right|thumb|250px| ''Phylogenetic relationship of CKX proteins in rice and Arabidopsis.'']]  
 
  [[File:Fggg.png|right|thumb|250px| ''Phylogenetic relationship of CKX proteins in rice and Arabidopsis.'']]  

Revision as of 13:01, 5 June 2014

Gn1a, is a gene for cytokinin oxidase/dehydrogenase (OsCKX2). Reduced expression of OsCKX2 causes cytokinin accumulation in inflorescence meristems and increases the number of reproductive organs, resulting in enhanced grain yield.

Annotated Information

Function

QTL analysis and molecular cloning. (A) Gross morphology of Koshihikari and Habataki at maturity.(D) Comparison of grain number in the main panicle of Koshihikari (Ko), Habataki (Ha), and 5150. (H) High-resolution linkage map of Gn1a. (I) OsCKX2 structure and mutation sites in Habataki (blue) and 5150 (red). (K) Comparison of grain number per main panicle in nontransgenic and transgenic lines. 2 copy CKX2, transgenic [1]).

Expression level of OsCKX2 can influence the amount of phytohormone cytokinin,Reduced expression of OsCKX2 causes cytokinin accumulation in inflorescence meristems and increases the number of reproductive organs, resulting in enhanced grain yield.Transgenic plants carrying two copies of the sense strand of OsCKX2 that was highly expressed showed reduced grain numbers compared to TC65. However, transgenic plants with antisense strands of OsCKX2 that had reduced levels of expression developed higher grain numbers. OsCKX2 reduce CKX activity in Habataki, NIL-Gn1a, and 5150, and the increased production of CK conjugates to reduce the overall CK activity .

Protein Structure

Conserved domains on OsCKX2.

The OsCKX2 of Koshihikari and Habataki consist of four exons and three introns and encode proteins of 565 or 563 amino acids, respectively. the region between 74 – 255 is FAD-binding PCMH-type domian. it has UDP-N-acetylmuramate dehydrogenase activity, cytokinin dehydrogenase activity and flavin adenine dinucleotide binding.[2]


Expression

Expression profile of OsCKX2.

transgenic rice harboring an OsCKX2 promoter::β-glucuronidase (GUS) construct. GUS expression was observed mainly in the vascular tissue in developing culms, inflorescence meristems, and young flowers in the T2 generation of transgenic plants . The expression of OsCKX2 in inflorescence meristems might regulate the CK level to control flower number. CK is known to be translocated acropetally via the xylem and systemically via the phloem . The high levels of expression in these tissues suggest that OsCKX2 plays a role in regulating CK levels in the vascular system of developing culms, where CK is transported to the inflorescence meristems[1]. The expression of OsCKX2 will directly influence the amount of cytokinin oxidase/dehydrogenase which degrades the phytohormone cytokinin, so the expression level of OsCKX2 will directly affect the Rice Grain Production by causeing cytokinin accumulation in inflorescence meristems and increases the number of reproductive organs.The expression of OsCKX2 in inflorescence meristems might regulate the CK level to control flower number. CK is known to be translocated acropetally via the xylem and systemically via the phloem (35). The high levels of expression in these tissues suggest that OsCKX2 plays a role in regulating CK levels in the vascular system of developing culms, where CK is transported to the inflorescence meristems.

Evolution

Phylogenetic relationship of CKX proteins in rice and Arabidopsis.

Phylogenetic relationship of CKX proteins in rice and Arabidopsis.[1]

Labs working on this gene

Please input related labs here.

  • Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya 464-8601, Japan
  • Plant Science Center, RIKEN, Yokohama 230-0045, Japan

References

  1. 1.0 1.1 1.2 Ashikari, M., Sakakibara, H., Lin, S., Yamamoto, T., Takashi, T., Nishimura, A., ... & Matsuoka, M. (2005). Cytokinin oxidase regulates rice grain production. Science, 309(5735), 741-745.
  2. http://www.uniprot.org/uniprot/Q4ADV8


Structured Information

Gene Name

Os01g0197700

Description

OsCKX2,cytokinin oxidase/dehydrogenase

Version

AB205193.1 GI:71609872.(gene version=Gene ID: 4327334)

Length

1698 bp

Definition

Oryza sativa Japonica Group OsCKX2 mRNA for cytokinin oxidase/dehydrogenase, complete cds.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:5273310..5274501

Sequence Coding Region

1..625,717..1192

Expression

GEO Profiles:Os01g0197700

Genome Context

<gbrowseImage1> name=NC_008394:5273310..5274501 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:5273310..5274501 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgaagcaagagcaggtcaggatggcagtgctcctcatgctcaactgcttcgtcaaggccacggcgccgccgccatggccgccgtcggcttcgtccgcctccttcctcgacgacctcggcgacctcggcatcgcgccgctcatccgcgccgacgaggcgggcaccgcgcgcgcctccgccgactttggcaacctctccgtcgccggcgtcggggcgcctcggctcgccgccgccgccgccgtgctctacccgtcgcgccccgccgacatcgccgcgctgctgcgcgcgtcgtgcgcacgcccggcgccgttcgcggtgtccgcgcgggggtgtggccactcggtgcacggccaggcctccgcgcccgacggcgtcgtcgtcgacatggcgtcgctcggccgcctgcagggcggcggcgcgcggcgcctcgccgtgtcagtggaggggcggtacgtcgacgccggcggcgagcagctgtgggtggacgtgctgcgcgcgtccatggcgcacgggctcacgccggtgtcgtggacagactacctccacctcaccgtcggcggcacgctgtccaacgccggcatcagcggccaggccttccgccatggcccccagatttccaacgtgctagagctcgacgtcatcaccggtgtcggggagatggtgacgtgctcgaaggagaaggcgccggacctgttcgacgcggtgctgggcgggctggggcagttcggcgtcatcacgcgggcgcgcatcccgctcgcgccggcgccggcgagggcgcggtgggtgcggttcgtgtacacgacggcggcggcgatgacggccgaccaggagcgcctcatcgccgtcgatcgcgccggcggcgccggcgcggtgggcgggctgatggactacgtcgagggctcggtccacctgaaccagggcctggtcgagacctggcgcacgcagccgcagccgccttcgccgtcctcctcctcctcctcatccttcttctccgacgccgacgaggcccgcgtcgccgcgctcgccaaggaggccggcggcgtgctgtatttcctcgagggcgccatctacttcggcggcgccgccgggccgtccgccgccgacgttgacaagaggatggatgtgctgcgtcgcgagctgcggcacgagcgcgggttcgtgttcgcgcaggacgtggcgtacgccgggttcctggaccgcgtccacgacggcgagctcaagctccgcgccgcggggctctgggacgtgccgcacccatggctgaacctgttcctcccccgctccggcgtcctcgccttcgccgacggcgtcttccacggcatcctcagccgcacccccgccatgggccccgtcctcatctaccccatgaaccgcaacaagtgggacagtaacatgtcggcagtgatcaccgacgacgacggtgacgaggtgttctacacggtggggatcctgcggtcggcggcggcggccggcgacgtggggaggctggaggagcagaacgacgagatcttgggtttctgcgaggtggccgggatagcctacaagcagtacctgccttactacggcagccaggcagagtggcagaagcggcacttcggtgccaatctctggccaagattcgtgcagcggaagagcaagtatgatccaaaggccatcctgtcccgtggccaggggattttcacgtcaccactcgcatga</cdnaseq>

Protein Sequence

<aaseq>MKQEQVRMAVLLMLNCFVKATAPPPWPPSASSASFLDDLGDLGI

                    APLIRADEAGTARASADFGNLSVAGVGAPRLAAAAAVLYPSRPADIAALLRASCARPA
                    PFAVSARGCGHSVHGQASAPDGVVVDMASLGRLQGGGARRLAVSVEGRYVDAGGEQLW
                    VDVLRASMAHGLTPVSWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVLELDVITGVG
                    EMVTCSKEKAPDLFDAVLGGLGQFGVITRARIPLAPAPARARWVRFVYTTAAAMTADQ
                    ERLIAVDRAGGAGAVGGLMDYVEGSVHLNQGLVETWRTQPQPPSPSSSSSSSFFSDAD
                    EARVAALAKEAGGVLYFLEGAIYFGGAAGPSAADVDKRMDVLRRELRHERGFVFAQDV
                    AYAGFLDRVHDGELKLRAAGLWDVPHPWLNLFLPRSGVLAFADGVFHGILSRTPAMGP
                    VLIYPMNRNKWDSNMSAVITDDDGDEVFYTVGILRSAAAAGDVGRLEEQNDEILGFCE
                    VAGIAYKQYLPYYGSQAEWQKRHFGANLWPRFVQRKSKYDPKAILSRGQGIFTSPLA</aaseq>
Gene Sequence

<dnaseqindica>1..625#717..1192#ATGGCAGTGCTCCTCATGCTCAACTGCTTCGTCAAGGCCACGGCGCCGCCGCCATGGCCGCCGTCGGCTT CGTCCGCCTCCTTCCTCGACGACCTCGGCGACCTCGGCATCGCGCCGCTCATCCGCGCCGACGAGGCGGG CACCGCGCGCGCCTCCGCCGACTTTGGCAACCTCTCCGTCGCCGGCGTCGGGGCGCCTCGGCTCGCCGCC GCCGCCGCCGTGCTCTACCCGTCGCGCCCCGCCGACATCGCCGCGCTGCTGCGCGCGTCGTGCGCACGCC CGGCGCCGTTCGCGGTGTCCGCGCGGGGGTGTGGCCACTCGGTGCACGGCCAGGCCTCCGCGCCCGACGG CGTCGTCGTCGACATGGCGTCGCTCGGCCGCCTGCAGGGCGGCGGCGCGCGGCGCCTCGCCGTGTCAGTG GAGGGGCGGTACGTCGACGCCGGCGGCGAGCAGCTGTGGGTGGACGTGCTGCGCGCGTCCATGGCGCACG GGCTCACGCCGGTGTCGTGGACAGACTACCTCCACCTCACCGTCGGCGGCACGCTGTCCAACGCCGGCAT CAGCGGCCAGGCCTTCCGCCATGGCCCCCAGATTTCCAACGTGCTAGAGCTCGACGTCATCACCGGTACG TAGATCCATCACATCTACTAAGACACGCGCCGCCATGATCGAGGTAATTAAGGTATAGGTGTTTTGACGT ATACATGTATCTGCAGGTGTCGGGGAGATGGTGACGTGCTCGAAGGAGAAGGCGCCGGACCTGTTCGACG CGGTGCTGGGCGGGCTGGGGCAGTTCGGCGTCATCACGCGGGCGCGCATCCCGCTCGCGCCGGCGCCGGC GAGGGCGCGGTGGGTGCGGTTCGTGTACACGACGGCGGCGGCGATGACGGCCGACCAGGAGCGCCTCATC GCCGTCGATCGCGCCGGCGGCGCCGGCGCGGTGGGCGGGCTGATGGACTACGTCGAGGGCTCGGTCCACC TGAACCAGGGCCTGGTCGAGACCTGGCGCACGCAGCCGCAGCCGCCTTCGCCGTCCTCCTCCTCCTCCTC ATCCTTCTTCTCCGACGCCGACGAGGCCCGCGTCGCCGCGCTCGCCAAGGAGGCCGGCGGCGTGCTGTAT TTCCTCGAGGGCGCCATCTACTTCGGCGGCGCCGCCGGGCCGTCCGCCGCCGACGTTGACAAGGTATACT AG </dnaseqindica>

External Link(s)

NCBI Gene:Os01g0197700, [1]