Difference between revisions of "Atp8"
(Created page with "{{Mitochondrion| GeneName = atp8| Description = Subunit 8 of the F0 sector of mitochondrial inner membrane F1-F0 ATP synthase, encoded on the mitochondrial genome| Version = G...") |
|||
| Line 1: | Line 1: | ||
| + | Please input one-sentence summary here. | ||
| + | |||
| + | ==Annotated Information== | ||
| + | ===Function=== | ||
| + | Please input function information here. | ||
| + | |||
| + | |||
| + | ===Expression=== | ||
| + | Please input expression information here. | ||
| + | |||
{{Mitochondrion| | {{Mitochondrion| | ||
GeneName = atp8| | GeneName = atp8| | ||
Revision as of 13:34, 5 June 2014
Please input one-sentence summary here.
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
| Gene Name |
atp8 |
|---|---|
| Description |
Subunit 8 of the F0 sector of mitochondrial inner membrane F1-F0 ATP synthase, encoded on the mitochondrial genome |
| Version |
GeneID:807862 |
| Length |
207 bp |
| Definition |
Oryza sativa Japonica Group atp8, Mitochondrion gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Mitochondrion:7784..7990 |
| Sequence Coding Region |
7784..7990 |
| Genome Context |
<gbrowseImage1> name=NC_011033:7784..7990 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage1> |
| Gene Structure (RNA Editing) |
<gbrowseImage2> name=NC_011033:263141..263365 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage2> |
| Protein Sequence |
<aaseq>MPQLDTSKWFITILSVMFTLFVLFQVKLSNYNFPLDLSSKSEDLKKNKTPWELKWTKIYLPHLLPLQ</aaseq> |
| Gene Sequence |
<dnaseqindica>1..225#ATGCCCCAACTAAATACCGCCGTATGACCCACCATAATTACCCCCATACTCCTGACACTATTTCTCGTCA CCCAACTAAAAATATTAAATTCAAATTACCATCTACCCCCCTCACCAAAACCCATAAAAATAAAAAACTA CAATAAACCCTGAGAACCAAAATGAACGAAAATCTATTCGCTTCATTCGCTGCCCCCACAATCCTAG</dnaseqindica> |
| External Link(s) |
