Difference between revisions of "Os06g0701600"

From RiceWiki
Jump to: navigation, search
(Function)
Line 4: Line 4:
 
===Function===
 
===Function===
 
Please input function information here.
 
Please input function information here.
 +
OsHKT2; 4 features expressed in Xenopus oocytes were then analyzed. Even in the case of very low external K + concentration is not detected OsHKT2; Ca2 + permeability capacity of 4, specific performance under high Ca2 + conditions OsHKT2; zero flow potential 4, and OsHKT2; 4 a zero flow potential and conductance lack of sensitivity to external Ca2 +. Before detected OsHKT2; 4 for Ca2 + permeability may be due to activation of Xenopus oocytes induced conductance source. Compared with Na +, OsHKT2; 4 K + permeability exhibits a high capacity (K +> Rb + ≈ Cs +> Na + ≈ Li + ≈ NH4 +). By detecting OsHKT2; 4 external pH sensitive current found in most physiological ionic conditions OsHKT2; 4 does not significantly penetrate H +. Medium further contains Na + and K + in the analysis showed that the low Na + in the external conditions, OsHKT2; 4 K + selective transporter proteins play function, but (> 10mM) are transported under high Na + Na +. These data indicate OsHKT2; 4 is K +, Na + permeability HKT transporter subfamily a new type of function. In addition, OsHKT2; 4 high K + permeability of the system to support the hypothesis that transporters involved in plant K +.
  
 
===Expression===
 
===Expression===

Revision as of 02:07, 6 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. OsHKT2; 4 features expressed in Xenopus oocytes were then analyzed. Even in the case of very low external K + concentration is not detected OsHKT2; Ca2 + permeability capacity of 4, specific performance under high Ca2 + conditions OsHKT2; zero flow potential 4, and OsHKT2; 4 a zero flow potential and conductance lack of sensitivity to external Ca2 +. Before detected OsHKT2; 4 for Ca2 + permeability may be due to activation of Xenopus oocytes induced conductance source. Compared with Na +, OsHKT2; 4 K + permeability exhibits a high capacity (K +> Rb + ≈ Cs +> Na + ≈ Li + ≈ NH4 +). By detecting OsHKT2; 4 external pH sensitive current found in most physiological ionic conditions OsHKT2; 4 does not significantly penetrate H +. Medium further contains Na + and K + in the analysis showed that the low Na + in the external conditions, OsHKT2; 4 K + selective transporter proteins play function, but (> 10mM) are transported under high Na + Na +. These data indicate OsHKT2; 4 is K +, Na + permeability HKT transporter subfamily a new type of function. In addition, OsHKT2; 4 high K + permeability of the system to support the hypothesis that transporters involved in plant K +.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os06g0701600

Description

Cation transporter family protein

Version

NM_001065020.1 GI:115469771 GeneID:4341970

Length

1749 bp

Definition

Oryza sativa Japonica Group Os06g0701600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:30411807..30413555

Sequence Coding Region

30411816..30412011,30412120..30412350,30412435..30413537

Expression

GEO Profiles:Os06g0701600

Genome Context

<gbrowseImage1> name=NC_008399:30411807..30413555 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:30411807..30413555 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcctattcggctgcatatctttgtcagttctgcaaggcatgccatcaactcgtcggcattgatttgtcggttcatcgcattccatcttagcccgcttttgattcacctgtcctattttcttatcattgatgtacttggttttgttgccttggtggtgctcaggccaagcaaccacaagtacaatcctcgctatatcgatatgtttttcctatcgacatctgcagttacagtcacaggattagccaccacacaaatggaggatctttctagctctcagatagctgtcctgactctcttgatgttcttaggaagtgagatgttcctttcctttcttggccttgtccttgagtcgagcaagcaaaacaagcatgatcctgaaaaccgtagagtaagttcagttaccgtgtgtgagcagtcacatctagaagaggcaattccacaaactccatccatgaactccactgatatcaagaggagctgccacaaatacttagtgtttgtggtgttggcatacatgattattattcttgtcactggttctctattggtgttcatgtacatagctcatgtttcaagtgctagagatgtgctaacaaggaaaagcatcaacaaagctctcttctcgatatcggtcacagtctcctcatttacaaatggagggttattgccgacaaatgagagtatggctgtattctcctcaaacaatggcctcctgttgctactcatcggccagattcttgcaggcagcacactgctccctatgtttctgaggttggtgatatgggcattgagaggactaagattagcaaaagctgaagagccagacttcatgatgaacaacagcagctcagtaggtttcagtcacctgctacctaacttgcagacaatatttcttgcagctgtggaggttgcttttgtaggcatgacagtcatcctcttctgctgcttgaactgggattctgcagtgtttgcagggctaacctccctccagaagataaccaatgcattgttcatggcagtgagtgcaaggcaggcaggagaaaattccattgattgttcccttgttgcgccagcggctttagtactattcatggtcatgatgtacactccatccttgacaaagttgttctcagcatgtcaagatcacaaacaaatcggcccggaaagcgacgatagaacaagcaaggggaaaccattcctgaagacgatggcattttcaccactagccttcaacaccacagtgataatgctggtctgcatcactgaaaggagatcgatctccactgaccctctcaatttctccacatttaacatcatctttgaggtgataagtgcctacgggaacattgggttgtccactggctacagctgctcgagacagctacagcaccaggatgggattgcttgccatgagaagccatacagcttctcggggtggtggagtgaaccagggaagctgattcttgttcttgcgatgctctacgggaggctcaactcaaaggattccacaagcgcacgaactaggtga</cdnaseq>

Protein Sequence

<aaseq>MPIRLHIFVSSARHAINSSALICRFIAFHLSPLLIHLSYFLIID VLGFVALVVLRPSNHKYNPRYIDMFFLSTSAVTVTGLATTQMEDLSSSQIAVLTLLMF LGSEMFLSFLGLVLESSKQNKHDPENRRVSSVTVCEQSHLEEAIPQTPSMNSTDIKRS CHKYLVFVVLAYMIIILVTGSLLVFMYIAHVSSARDVLTRKSINKALFSISVTVSSFT NGGLLPTNESMAVFSSNNGLLLLLIGQILAGSTLLPMFLRLVIWALRGLRLAKAEEPD FMMNNSSSVGFSHLLPNLQTIFLAAVEVAFVGMTVILFCCLNWDSAVFAGLTSLQKIT NALFMAVSARQAGENSIDCSLVAPAALVLFMVMMYTPSLTKLFSACQDHKQIGPESDD RTSKGKPFLKTMAFSPLAFNTTVIMLVCITERRSISTDPLNFSTFNIIFEVISAYGNI GLSTGYSCSRQLQHQDGIACHEKPYSFSGWWSEPGKLILVLAMLYGRLNSKDSTSART R</aaseq>

Gene Sequence

<dnaseqindica>1545..1740#1206..1436#19..1121#ctctgccctctatctccaatgcctattcggctgcatatctttgtcagttctgcaaggcatgccatcaactcgtcggcattgatttgtcggttcatcgcattccatcttagcccgcttttgattcacctgtcctattttcttatcattgatgtacttggttttgttgccttggtggtgctcaggccaagcaaccacaagtacaatcctcgctatatcgatatgtttttcctatcgacatctgcagttacagtcacaggattagccaccacacaaatggaggatctttctagctctcagatagctgtcctgactctcttgatgttcttaggaagtgagatgttcctttcctttcttggccttgtccttgagtcgagcaagcaaaacaagcatgatcctgaaaaccgtagagtaagttcagttaccgtgtgtgagcagtcacatctagaagaggcaattccacaaactccatccatgaactccactgatatcaagaggagctgccacaaatacttagtgtttgtggtgttggcatacatgattattattcttgtcactggttctctattggtgttcatgtacatagctcatgtttcaagtgctagagatgtgctaacaaggaaaagcatcaacaaagctctcttctcgatatcggtcacagtctcctcatttacaaatggagggttattgccgacaaatgagagtatggctgtattctcctcaaacaatggcctcctgttgctactcatcggccagattcttgcaggcagcacactgctccctatgtttctgaggttggtgatatgggcattgagaggactaagattagcaaaagctgaagagccagacttcatgatgaacaacagcagctcagtaggtttcagtcacctgctacctaacttgcagacaatatttcttgcagctgtggaggttgcttttgtaggcatgacagtcatcctcttctgctgcttgaactgggattctgcagtgtttgcagggctaacctccctccagaagataaccaatgcattgttcatggcagtgagtgcaaggcaggcaggagaaaattccattgattgttcccttgttgcgccagcggctttagtactattcatggtcatgatgtgagttcctctctttcaagctcttcacatttttcaggcaacaatcagaagagataacataacacggttgcttacatttctcaggtacactccatccttgacaaagttgttctcagcatgtcaagatcacaaacaaatcggcccggaaagcgacgatagaacaagcaaggggaaaccattcctgaagacgatggcattttcaccactagccttcaacaccacagtgataatgctggtctgcatcactgaaaggagatcgatctccactgaccctctcaatttctccacatttaacatcatctttgaggtgataaggtaattaagttgcacatctactcaccaaattcttcttctgatactgttcttgctccctccatgattaattcagctaatttattcatcacccattgcttctgcacacagtgcctacgggaacattgggttgtccactggctacagctgctcgagacagctacagcaccaggatgggattgcttgccatgagaagccatacagcttctcggggtggtggagtgaaccagggaagctgattcttgttcttgcgatgctctacgggaggctcaactcaaaggattccacaagcgcacgaactaggtgatgatgttat</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0701600, RefSeq:Os06g0701600