Difference between revisions of "Os07g0438800"

From RiceWiki
Jump to: navigation, search
(Evolution)
m (Evolution)
Line 10: Line 10:
 
===Evolution===
 
===Evolution===
 
*OsPHR1(AK063486) and OsPHR2(AK100065)are two homologous genes in rice through a TBLASTN search in the National Center for Biotechnology Information (NCBI) database according to their amino acid sequence identity (SI) to AtPHR1 with 51.7% and 45.5%, respectively. OsPHR1 and OsPHR2 share 43.6% SI with each other. The full-length complementary DNAs (cDNAs) of the two genes were obtained from rice (‘Nipponbare’), followed by PCR amplification using primers predicted from the cDNA sequences. Based on sequencing verification, the obtained cDNAs were identical to the sequence data released from NCBI.OsPHR1andOsPHR2are 1,991- and 1,941-bp long, respectively, and contain an open reading frame (ORF) encoding a predicted protein of 428 and 426 amino acids, respectively. The gene structure analysis showed that both genes have a similar splicing pattern, with the exception of one more exon and intron present in OsPHR2(Fig. 1A).OsPHR1 and OsPHR2 belong to the same subgroup with AtPHR1 and CrPSR1 and are more closely related to AtPHR1 (Fig. 1B).
 
*OsPHR1(AK063486) and OsPHR2(AK100065)are two homologous genes in rice through a TBLASTN search in the National Center for Biotechnology Information (NCBI) database according to their amino acid sequence identity (SI) to AtPHR1 with 51.7% and 45.5%, respectively. OsPHR1 and OsPHR2 share 43.6% SI with each other. The full-length complementary DNAs (cDNAs) of the two genes were obtained from rice (‘Nipponbare’), followed by PCR amplification using primers predicted from the cDNA sequences. Based on sequencing verification, the obtained cDNAs were identical to the sequence data released from NCBI.OsPHR1andOsPHR2are 1,991- and 1,941-bp long, respectively, and contain an open reading frame (ORF) encoding a predicted protein of 428 and 426 amino acids, respectively. The gene structure analysis showed that both genes have a similar splicing pattern, with the exception of one more exon and intron present in OsPHR2(Fig. 1A).OsPHR1 and OsPHR2 belong to the same subgroup with AtPHR1 and CrPSR1 and are more closely related to AtPHR1 (Fig. 1B).
[[File:1HF1.jpg|frame|Fig. 1. Structures of the OsPHR1andOsPHR2genes and phylogenetic analysis with other related MYB-CC proteins in Arabidopsis and
+
[[File:HLS1.jpg|frame|Fig. 1. Structures of the OsPHR1andOsPHR2genes and phylogenetic analysis with other related MYB-CC proteins in Arabidopsis and
 
Chlamydomonas reinhardtii. A, Structures of the OsPHR1andOsPHR2 genes. Exons are indicated as black boxes and introns as white boxes.Numbers indicate the length of each exon and intron. ATG and stop codon are shown with arrowheads. B, Phylogram of proteins sharing the MYB and predicted CC domains constructed using the Clustal(Thompson et al., 1997) program and the neighbor-joining method. The numbers above the lines refer to bootstrap values (of 100 samples).
 
Chlamydomonas reinhardtii. A, Structures of the OsPHR1andOsPHR2 genes. Exons are indicated as black boxes and introns as white boxes.Numbers indicate the length of each exon and intron. ATG and stop codon are shown with arrowheads. B, Phylogram of proteins sharing the MYB and predicted CC domains constructed using the Clustal(Thompson et al., 1997) program and the neighbor-joining method. The numbers above the lines refer to bootstrap values (of 100 samples).
 
Scale bar, 0.1 substitutions per site.]]
 
Scale bar, 0.1 substitutions per site.]]
[[File:.jpg]]
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 04:16, 6 June 2014

Please input one-sentence summary here.

Annotated Information

Function

  • Previous research has demonstrated that AtPHR1 plays a central role in phosphate (Pi)-starvation signaling in Arabidopsis thaliana.According to Jie Zhou; FangChang Jiao; Zhongchang Wu;et.al, two OsPHR genes from rice (Oryza sativa) were isolated and designated as OsPHR1 and OsPHR2 based on amino acid sequence homology to AtPHR1. Their functions in Pi signaling in rice were investigated using transgenic plants.

Expression

Please input expression information here.

Evolution

  • OsPHR1(AK063486) and OsPHR2(AK100065)are two homologous genes in rice through a TBLASTN search in the National Center for Biotechnology Information (NCBI) database according to their amino acid sequence identity (SI) to AtPHR1 with 51.7% and 45.5%, respectively. OsPHR1 and OsPHR2 share 43.6% SI with each other. The full-length complementary DNAs (cDNAs) of the two genes were obtained from rice (‘Nipponbare’), followed by PCR amplification using primers predicted from the cDNA sequences. Based on sequencing verification, the obtained cDNAs were identical to the sequence data released from NCBI.OsPHR1andOsPHR2are 1,991- and 1,941-bp long, respectively, and contain an open reading frame (ORF) encoding a predicted protein of 428 and 426 amino acids, respectively. The gene structure analysis showed that both genes have a similar splicing pattern, with the exception of one more exon and intron present in OsPHR2(Fig. 1A).OsPHR1 and OsPHR2 belong to the same subgroup with AtPHR1 and CrPSR1 and are more closely related to AtPHR1 (Fig. 1B).
Fig. 1. Structures of the OsPHR1andOsPHR2genes and phylogenetic analysis with other related MYB-CC proteins in Arabidopsis and Chlamydomonas reinhardtii. A, Structures of the OsPHR1andOsPHR2 genes. Exons are indicated as black boxes and introns as white boxes.Numbers indicate the length of each exon and intron. ATG and stop codon are shown with arrowheads. B, Phylogram of proteins sharing the MYB and predicted CC domains constructed using the Clustal(Thompson et al., 1997) program and the neighbor-joining method. The numbers above the lines refer to bootstrap values (of 100 samples). Scale bar, 0.1 substitutions per site.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os07g0438800

Description

Similar to Phosphate starvation regulator protein (Regulatory protein of P- starvation acclimation response Psr1)

Version

NM_001066050.2 GI:297607134 GeneID:4343086

Length

5602 bp

Definition

Oryza sativa Japonica Group Os07g0438800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:15413930..15419531

Sequence Coding Region

15414734..15415336,15416550..15416757,15416839..15416915,15417000..15417039,15417150..15417210
,15417857..15417926,15418751..15418952,15419048..15419067

Expression

GEO Profiles:Os07g0438800

Genome Context

<gbrowseImage1> name=NC_008400:15413930..15419531 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:15413930..15419531 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagagaataagcaccaatcagctctacaattctggaattccggtgactgtgccatcgcctctgcctgctataccagctaccctggatgaaaacattcccaggattccagatgggcagaatgttccgcgggagagagaattgagaagcacacctatgccacctcatcagaatcagagtactgttgctcctcttcatgggcattttcagtccagtaccgggtctgttgggcctctgcgttcgtcccaggcgataaggttctcttcagtttcaagcaatgagcaatatacaaatgccaatccttacaattctcaaccgccgagtagtgggagttcttcaacgctcaattatggatcacaatatggaggctttgaaccttccttgactgattttccaagagatgctgggccgacgtggtgtcctgatccagttgatggcttgcttggatatacagatgatgtccctgctgggaacaatttgactgaaaacagttctattgcagctggtgatgaacttgccaagcaaagtgaatggtggaatgattttatgaattatgactggaaagatattgataacacagcttgtactgaaactcaaccacaggttggaccagctgcgcaatcatctgtcgcagttcaccaatcagctgcccaacaatcagtttcatctcaatcaggagaaccttctgcagttgctataccctcgccctctggtgcctccaatacctccaactccaagacacgaatgagatggactcctgaacttcatgagcgctttgtagatgctgtcaatctacttggtggcagtgaaaaagctactcccaagggtgtgttaaagctaatgaaggcagacaatttgaccatttatcatgttaaaagtcaccttcagaaatacagaacagctcgatacagaccagaattgtctgaaggttcttcagaaaagaaggcagcctcaaaagaggacataccatcaatagatctgaaaggagggaactttgatctcactgaggcattgcgtctccagttagaactccaaaagaggcttcatgaacagcttgagatccaaagaagtttgcagctgagaattgaggagcaagggaagtgccttcagatgatgctcgagcagcagtgcatacctgggacagacaaggcggtggatgcttcaacctcagcagaaggaacaaagccatcttctgatcttccagaatcttctgccgtgaaggatgttccagagaacagtcagaacggaatagccaaacaaacagaatcaggtgacagataa</cdnaseq>

Protein Sequence

<aaseq>MERISTNQLYNSGIPVTVPSPLPAIPATLDENIPRIPDGQNVPR ERELRSTPMPPHQNQSTVAPLHGHFQSSTGSVGPLRSSQAIRFSSVSSNEQYTNANPY NSQPPSSGSSSTLNYGSQYGGFEPSLTDFPRDAGPTWCPDPVDGLLGYTDDVPAGNNL TENSSIAAGDELAKQSEWWNDFMNYDWKDIDNTACTETQPQVGPAAQSSVAVHQSAAQ QSVSSQSGEPSAVAIPSPSGASNTSNSKTRMRWTPELHERFVDAVNLLGGSEKATPKG VLKLMKADNLTIYHVKSHLQKYRTARYRPELSEGSSEKKAASKEDIPSIDLKGGNFDL TEALRLQLELQKRLHEQLEIQRSLQLRIEEQGKCLQMMLEQQCIPGTDKAVDASTSAE GTKPSSDLPESSAVKDVPENSQNGIAKQTESGDR</aaseq>

Gene Sequence

<dnaseqindica>805..1407#2621..2828#2910..2986#3071..3110#3221..3281#3928..3997#4822..5023#5119..5138#cctcgcttctctctctatcgcaggcgaaggcgaaggcgaaggattcgggctcagctcctccgcctccgccgatctctcgccggaggtgaggcctcctcctccgccgtctatctgtatctctgtctgtagctcagcgtcgggcccggttcaatccacagctcccccggggtcatctgcgctcggctcggtgaggaattgttgggattcggtcgggttcgttggttgggttgggttggggggtacttgacttcgttctggttgtatggtggaattgtgcggcgggtgtgattagcttgatgagattaggctggggtttggtttggattggtggagtcgtgtgaggagggcgtgttgggtgagggaggatatgggtatcttgggatcgtgggattcgtggcccctctgatttgaggctgatcagttggttatgttacgcatagagctttttcatgtttggatttgcgcgaaattcggcctaacctttgacgagaagagagatgattataggcttcaaagccgtgactaaggaagtcgtgttttttttttgtttaattggagcaataggctggggattgataattttcatattgacatgaagattctgctgtacactactgaaatttatgcttccatacccttttgtgtggtcagaggtttcttttgtcatgattgggttgaacattcttttgttgcagatgtgtcagccctaggagaggagaagctttctttttttggaaaatcgagtcaacaaaaggtcttgccaattaacacagtgaaggataattctggcttgagtgtttgtaaatggagagaataagcaccaatcagctctacaattctggaattccggtgactgtgccatcgcctctgcctgctataccagctaccctggatgaaaacattcccaggattccagatgggcagaatgttccgcgggagagagaattgagaagcacacctatgccacctcatcagaatcagagtactgttgctcctcttcatgggcattttcagtccagtaccgggtctgttgggcctctgcgttcgtcccaggcgataaggttctcttcagtttcaagcaatgagcaatatacaaatgccaatccttacaattctcaaccgccgagtagtgggagttcttcaacgctcaattatggatcacaatatggaggctttgaaccttccttgactgattttccaagagatgctgggccgacgtggtgtcctgatccagttgatggcttgcttggatatacagatgatgtccctgctgggaacaatttgactgaaaacagttctattgcagctggtgatgaacttgccaagcaaagtgaatggtggaatgattttatgaattatgactggaaagatattgataacacagcttgtactgaaactcaaccacaggtatgacagtttctgctattttggtggctgaacttggggagtaattcttcattatctaagaacaattctactcttatttggctaaactatttcctaaattaactgttatttcatgctgtgatgtgttctttgttagtgagtttgaaatgaagcatcatcttgattattgactttctaaaattatccttttgtttctgcaacatccaattgtccgtgacattaccgtgtttgatgcatattatgtacgatgtgtttatcagattagtatatttcgttcttcgtatctccagctcaaaactgccacttaataaattatctttagcattatggcagtctagcgaccccaataagatttacatgtttgcgttgacaaatgcaattattcttatatgtgacatgcaagcaaaacgtctacactttgctttgtttaacaaatgtttactatagattggatgttttcaattgggcatgcttagccatgatgcatttgacacctagatagttaaaaaatgcgattatgctcaagataaaaggatgcagttgctgcaaccttgtagttttcctggctccatataaccaagcaaaaaacatgatgactttactgtatgtagaattgtggagagtcatcttgaatgagcttgggcaggcttgacttggtttgaactgcatgtaggtttctgctcttattatgtataagtatgaattatagggattttcttgacagaagctcaaataggctccatgtttgctcaagagaagctcaacaggtttaataacatatcataaccaaacttcagatcagctaaaatagcatagtgttgtttaaactaaaatttatacgaccaagttgcttgacggcttggttgccagggaactctctctctctctctctctcttttttaaacaaagaaaagggtataatattgacatacttgtgaagttttgagcttaaccaagaattttttttttaaccctgagatgatatctaaatttctttctggttgatatcatcaggataagcttaggcttgtttgggtgggtgctgccagtttccagttgagcttgaattaagactgtgggatgtgtcacatgtagttatccctaagtgccctatgctattcattgttgatgactactgcaaattctttagttcctagtcttctagacgcatccaacatgtaattgagtggtgctctatttatcttcaatataggttggaccagctgcgcaatcatctgtcgcagttcaccaatcagctgcccaacaatcagtttcatctcaatcaggagaaccttctgcagttgctataccctcgccctctggtgcctccaatacctccaactccaagacacgaatgagatggactcctgaacttcatgagcgctttgtagatgctgtcaatctacttggtggcagtgaaagtgtgtattgctttaagaaatgttacatctcctatgattgaactaattatgcatattgacatttattgtgaattgttgcagaagctactcccaagggtgtgttaaagctaatgaaggcagacaatttgaccatttatcatgttaaaagtcaccttcaggtctgttagttgtccctattgcatgatatttttgtgaaaaaaaattattcttatcttttcattttgagttaatttattttgcagaaatacagaacagctcgatacagaccagaattgtctgaaggtctgccacgttccactttttctgtgttttgctgcattcttttatttatttattttgttgccatgtattatttattttattgccatgttcatcaatttgagatttttcaggttcttcagaaaagaaggcagcctcaaaagaggacataccatcaatagatctgaaaggagggtaagtttgaaatcttcatgacttcattatgcttctaccttgcgatctcactgctgtgttctcttttattcatttggaatcctgtattcaatcatattattagcaaaactggttcagtgaaagattctccattaaaaggggctttcttggtataacaaaaggaataatttgttgatcaaatgcttaagatattttgttgatcagcaaactgtttttttgtaataggacaacaatactcgttacagcactgtgttctatattgaagtggcttggaaacaattctttattaccaatagatattcttattcaaactcgttgactctccttggtctccttggaactttctccttttgtattttctgttatttatttgtatcaaatgcaattgtgtctagtgaacagaaagcagtgatcttccacaataaaaaaaaaatctatctggtctttgtctggtctaatgttagtccttcattcttgcttgtattttgcctactaatctgatcgcaaatatggaatgtcctgctgtttttagccaacttgtaccgcaaatatgcaatggcctgctgttttagccaacttgtttgggcatccttaacattagaccatcttgtgaggtccgagtgttcattcttgtattctgttgcaggaactttgatctcactgaggcattgcgtctccagttagaactccaaaagaggcttcatgaacagcttgaggtatgtagcatactaatgaattgtttttcatgctttatatttcttctgaaaggaaggtggggaagggctttggtatgaagttcagaataaagtaggcaagcttcaagctatcatatagtactagtgtaagctgacttgtttgagctccatgcatataaagcaaagaacgaattagcgctttatggagttctttctattgtgaattatataaccgaccattaacatcatatgtggtaagcaaattgattggagtattaggtgaaaaaggatgccttaggaaaaaaaatccaaaagtatttcaaaccaagaccaaccgttaaaattagcatatggatgcagttattattttgttcagggtttagttttttttccgtacatgtaggttcttgcaatagagggcatcacagctcattaggaaaatatgaacttagctgttaatttctagtacttttttgccatatttgtattgttttcatctgtttttcttatcctttcatatcaacagtcggctaaacctgttgttgaacattgtctctgctcctttttactagacattcctagaaaaactagtttcatggattagctaggtctgccataacaggggccagggcattgaaaatctgctaagtctgctttagatgtttttgtctatgagatgcgttaaaagtgaagtaaccaaattccttacctagttgattaacatggattatgaaggaagctagaccaacatcaaagtgaacttctcatttccccaagctgttgactgcagggtgttgaactttctgaaattaacccttttggttcaatgcttatttgctctgcagatccaaagaagtttgcagctgagaattgaggagcaagggaagtgccttcagatgatgctcgagcagcagtgcatacctgggacagacaaggcggtggatgcttcaacctcagcagaaggaacaaagccatcttctgatcttccagaatcttctgccgtgaaggatgttccagagaacagtcagaacggaatagccaaacaaacaggcatgagaatccattaaagtcatattcatgctgctgataccagcttaataatgttgagattgagataattgatgatccttaaatttttgtttcagaatcaggtgacagataatgaggatgtgatgagggtctctccaagatgtggacccaagtggccattgaatgggctcgatggctatctgactgatgtttggcaaagctaaaattaaatcgtttttgccttttcacggggaacagaacattgttgtgaacagcatatcaaagcttgccccagcgcttgtagctagactttagttgtacagtaccccaaacacggcagcgacgattccgtgttaatgggatgatctttaggtttcagaaggcagcacaagcaaatttgcactgatgtactctttgtcaggtggtttgacttcttgctttctttgttgttagggactggatagcatggattaggaatttgattatgatgaactaattcaagaaattgccataatctttggtaccttgtgcgcctggaacatgtaaatggtaccaaacaacaatatgatatgtttaccttcatgttctatttggctt</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0438800, RefSeq:Os07g0438800