Difference between revisions of "Os03g0111300"
(→Expression) |
(→Function) |
||
| Line 10: | Line 10: | ||
You can also add sub-section(s) at will. | You can also add sub-section(s) at will. | ||
| − | == | + | ==Function== |
| − | + | Transfer lipids across membranes. May play a role in plant defense or in the biosynthesis of cuticle layers. | |
[1]J.P Douliez, T Michon, K Elmorjani, D Marion | [1]J.P Douliez, T Michon, K Elmorjani, D Marion | ||
Revision as of 05:18, 6 June 2014
Please input one-sentence summary here.
==Annotated Informatio
NsLTPs bind to a variety of lipid molecules and catalyze their transfer across membranes in vitro [2]. NsLTPs also have additional biological functions, including biosynthesis of cutin, involvement in defense against pathogens, and managing abiotic stress conditions imparted by temperature or drought [2] and [3]. The nsLTP superfamily possesses eight highly conserved cysteine residues forming four disulfide bonds [1] and [4]. NsLTPs are subdivided into two subfamilies that differ in molecular mass, nsLTP1 (9 kDa), and nsLTP2 (7 kDa) [1].
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Function
Transfer lipids across membranes. May play a role in plant defense or in the biosynthesis of cuticle layers.
[1]J.P Douliez, T Michon, K Elmorjani, D Marion Structure, biological and technological functions of lipid transfer proteins and indolines, the major lipid binding proteins from cereal kernels J. Cereal Sci., 32 (2000), pp. 1–20
[2]J.C Kader Lipid transfer proteins in plants Annu. Rev. Plant Physiol. Plant Mol. Biol., 47 (1996), pp. 627–654
[3]K.L Larsen, J.R Winther Surprisingly high stability of barley lipid transfer protein, LTP1, towards denaturant, heat, and proteases FEBS Lett., 488 (2001), pp. 145–148
[4]J.P Douliez, C Pato, H Rabesona, D Molle, D Marion Disulfide bond assignment, lipid transfer activity and secondary structure of a 7-kDa plant lipid transfer protein, LTP2 Eur. J. Biochem., 268 (2001), pp. 1400–1403
Structured Information
| Gene Name |
Os03g0111300 |
|---|---|
| Description |
Nonspecific lipid-transfer protein 2 (nsLTP2) (7 kDa lipid transfer protein) |
| Version |
NM_001055258.1 GI:115450244 GeneID:4331362 |
| Length |
476 bp |
| Definition |
Oryza sativa Japonica Group Os03g0111300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 3:630670..631145 |
| Sequence Coding Region |
630809..631099 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008396:630670..631145 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008396:630670..631145 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgatgaggaagttggcggtgttggtgttggcggtggcgatggtggcggcgtgcggcggcggcgtcgtgggtgtagcgggggccggttgcaacgctgggcagctgacggtgtgcacgggggcgatcgcgggcggggcgcggccgacggcggcgtgctgctccagcctgcgggcgcagcagggctgcttctgccagttcgccaaggacccgcgctacgggcgctacgtcaacagccccaacgcccgcaaggccgtctcctcctgcggcatcgccctccccacctgccactga</cdnaseq> |
| Protein Sequence |
<aaseq>MMRKLAVLVLAVAMVAACGGGVVGVAGAGCNAGQLTVCTGAIAG GARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH</aaseq> |
| Gene Sequence |
<dnaseqindica>47..337#gtacctcgcagcaccaagctagctagcttcgatcagtagctggaggatgatgaggaagttggcggtgttggtgttggcggtggcgatggtggcggcgtgcggcggcggcgtcgtgggtgtagcgggggccggttgcaacgctgggcagctgacggtgtgcacgggggcgatcgcgggcggggcgcggccgacggcggcgtgctgctccagcctgcgggcgcagcagggctgcttctgccagttcgccaaggacccgcgctacgggcgctacgtcaacagccccaacgcccgcaaggccgtctcctcctgcggcatcgccctccccacctgccactgatccatccatccatcgtctcctactcttttattttgtgatgtggtgtacgtgttcgtagtattgtcttggcgtcatctcgtcacgacgcgtatatgcatgcgcagtgcggcttttgaataaaaggggatcgaccgatgtt</dnaseqindica> |
| External Link(s) |