Difference between revisions of "Os03g0111300"

From RiceWiki
Jump to: navigation, search
(Annotated Informatio)
(Evolution)
Line 5: Line 5:
 
NsLTPs bind to a variety of lipid molecules and catalyze their transfer across membranes in vitro [2]. NsLTPs also have additional biological functions, including biosynthesis of cutin, involvement in defense against pathogens, and managing abiotic stress conditions imparted by temperature or drought [2] and [3]. The nsLTP superfamily possesses eight highly conserved cysteine residues forming four disulfide bonds [1] and [4]. NsLTPs are subdivided into two subfamilies that differ in molecular mass, nsLTP1 (9 kDa), and nsLTP2 (7 kDa) [1].
 
NsLTPs bind to a variety of lipid molecules and catalyze their transfer across membranes in vitro [2]. NsLTPs also have additional biological functions, including biosynthesis of cutin, involvement in defense against pathogens, and managing abiotic stress conditions imparted by temperature or drought [2] and [3]. The nsLTP superfamily possesses eight highly conserved cysteine residues forming four disulfide bonds [1] and [4]. NsLTPs are subdivided into two subfamilies that differ in molecular mass, nsLTP1 (9 kDa), and nsLTP2 (7 kDa) [1].
  
===Evolution===
+
==='''Sequence similarities'''===
Please input evolution information here.
+
Belongs to the plant LTP family. B11E subfamily.
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.

Revision as of 05:24, 6 June 2014

Please input one-sentence summary here.

Annotated Information

NsLTPs bind to a variety of lipid molecules and catalyze their transfer across membranes in vitro [2]. NsLTPs also have additional biological functions, including biosynthesis of cutin, involvement in defense against pathogens, and managing abiotic stress conditions imparted by temperature or drought [2] and [3]. The nsLTP superfamily possesses eight highly conserved cysteine residues forming four disulfide bonds [1] and [4]. NsLTPs are subdivided into two subfamilies that differ in molecular mass, nsLTP1 (9 kDa), and nsLTP2 (7 kDa) [1].

Sequence similarities

Belongs to the plant LTP family. B11E subfamily.

You can also add sub-section(s) at will.

Function

Transfer lipids across membranes. May play a role in plant defense or in the biosynthesis of cuticle layers.

Reference

[1]J.P Douliez, T Michon, K Elmorjani, D Marion Structure, biological and technological functions of lipid transfer proteins and indolines, the major lipid binding proteins from cereal kernels J. Cereal Sci., 32 (2000), pp. 1–20

[2]J.C Kader Lipid transfer proteins in plants Annu. Rev. Plant Physiol. Plant Mol. Biol., 47 (1996), pp. 627–654

[3]K.L Larsen, J.R Winther Surprisingly high stability of barley lipid transfer protein, LTP1, towards denaturant, heat, and proteases FEBS Lett., 488 (2001), pp. 145–148

[4]J.P Douliez, C Pato, H Rabesona, D Molle, D Marion Disulfide bond assignment, lipid transfer activity and secondary structure of a 7-kDa plant lipid transfer protein, LTP2 Eur. J. Biochem., 268 (2001), pp. 1400–1403

Structured Information

Gene Name

Os03g0111300

Description

Nonspecific lipid-transfer protein 2 (nsLTP2) (7 kDa lipid transfer protein)

Version

NM_001055258.1 GI:115450244 GeneID:4331362

Length

476 bp

Definition

Oryza sativa Japonica Group Os03g0111300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:630670..631145

Sequence Coding Region

630809..631099

Expression

GEO Profiles:Os03g0111300

Genome Context

<gbrowseImage1> name=NC_008396:630670..631145 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:630670..631145 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgatgaggaagttggcggtgttggtgttggcggtggcgatggtggcggcgtgcggcggcggcgtcgtgggtgtagcgggggccggttgcaacgctgggcagctgacggtgtgcacgggggcgatcgcgggcggggcgcggccgacggcggcgtgctgctccagcctgcgggcgcagcagggctgcttctgccagttcgccaaggacccgcgctacgggcgctacgtcaacagccccaacgcccgcaaggccgtctcctcctgcggcatcgccctccccacctgccactga</cdnaseq>

Protein Sequence

<aaseq>MMRKLAVLVLAVAMVAACGGGVVGVAGAGCNAGQLTVCTGAIAG GARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH</aaseq>

Gene Sequence

<dnaseqindica>47..337#gtacctcgcagcaccaagctagctagcttcgatcagtagctggaggatgatgaggaagttggcggtgttggtgttggcggtggcgatggtggcggcgtgcggcggcggcgtcgtgggtgtagcgggggccggttgcaacgctgggcagctgacggtgtgcacgggggcgatcgcgggcggggcgcggccgacggcggcgtgctgctccagcctgcgggcgcagcagggctgcttctgccagttcgccaaggacccgcgctacgggcgctacgtcaacagccccaacgcccgcaaggccgtctcctcctgcggcatcgccctccccacctgccactgatccatccatccatcgtctcctactcttttattttgtgatgtggtgtacgtgttcgtagtattgtcttggcgtcatctcgtcacgacgcgtatatgcatgcgcagtgcggcttttgaataaaaggggatcgaccgatgtt</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0111300, RefSeq:Os03g0111300