Difference between revisions of "Os05g0465800"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
Phosphatidylinositol 3-kinase (PI3K) has been reported to be important in normal plant growth and stress responses. In this
 +
study, it was verified that PI3K played a vital role in rice seed germination through regulating NADPH oxidase activity.
 +
Suppression of PI3K activity by inhibitors wortmannin or LY294002 could abate the reactive oxygen species (ROS) formation,
 +
which resulted in disturbance to the seed germination. And then, the signal cascades that PI3K promoted the ROS liberation
 +
was also evaluated. Diphenylene iodonium (DPI), an NADPH oxidase inhibitor, suppressed most of ROS generation in rice
 +
seed germination, which suggested that NADPH oxidase was the main source of ROS in this process. Pharmacological
 +
experiment and RT-PCR demonstrated that PI3K promoted the expression of Osrboh9. Moreover, functional analysis by
 +
native PAGE and the measurement of the 2, 3-bis-(2-methoxy-4-nitro-5-sulfophenyl)-2H-tetrazo-lium-5- carboxanilide (XTT)
 +
formazan concentration both showed that PI3K promoted the activity of NADPH oxidase. Furthermore, the western blot
 +
analysis of OsRac-1 demonstrated that the translocation of Rac-1 from cytoplasm to plasma membrane, which was known
 +
as a key factor in the assembly of NADPH oxidase, was suppressed by treatment with PI3K inhibitors, resulting in the
 +
decreased activity of NADPH oxidase. Taken together, these data favored the novel conclusion that PI3K regulated NADPH
 +
oxidase activity through modulating the recruitment of Rac-1 to plasma membrane and accelerated the process of rice seed
 +
germination
  
 
===Expression===
 
===Expression===
Please input expression information here.
 
  
 +
Changes of PI3K expression in rice seed after imbibition and the expression of PI3K is regulated by Ca2+. To determine the dynamic expression ofPI3Kin rice seed germination, the total RNA was extracted from the rice seed embryo after imbibition. The result of RT-PCR analysis suggested that PI3K might involve in the regulation of seed germination. Meanwhile, it was found that the expression ofPI3K was increased with the prolongation of imbibition time (Figure 1A).This expression peaked at 12 h and reached 30 times as many as seeds without treatment (Figure 1C). Interestingly, low concentration of Ca
 +
2+(below10 mM) could further increase the expression of PI3Kin rice seeds after germinated for 12 h. However, when the concentration of Ca2+ was up to 20 mM, thePI3Kexpression began to
 +
decrease slightly compared with the treatment with 10 mM
 +
CaCl2(Figure 1B, D).
 +
LY294002 and Wortmannin inhibit rice seed germination
 +
Next, Wortmannin and LY294002, two kinds of PI3K
 +
inhibitors with different action mechanisms, were used to test
 +
the role of PI3K in the de-coated (without pericarp) rice seed
 +
germination [21]. Following treatment with 60mM LY294002 at
 +
27uC for four days, the seed germination rate decreased to about
 +
67.3% compared with the control. And it was further decreased to
 +
54.0% when the concentration of LY294002 was increased to
 +
90mM (Figure 2A). The seed germination rate was 55.7% of the
 +
control in the presence of 20mM Wortmannin and it would be
 +
decreased to 31.7% of the control with 30mM Wortmannin
 +
(Figure 2B). Dynamics of seed germination revealed that, relative
 +
to the control, 60 mM LY294002 or 20mM Wortmannin
 +
displayed both significant inhibitory effects on the seed germination at any time point (Figure 2C). From these results, we
 +
reasonably concluded that PI3K played a positive role in rice seed
 +
germination.
 +
LY294002 and Wortmannin inhibit ROS production
 +
PI3K inhibitors suppressed the ROS production in guard cell,
 +
root hair, and pollen tube [18,19,23]. However, it was uncertain
 +
that PI3K inhibitors restrained the ROS formation in rice seed
 +
germination. In our case, it was found that exogenous hydrogen
 +
peroxide (H2O2) could partly rescue the inhibitory effects of PI3K
 +
inhibitors on rice seed germination (Figure S1A). This finding
 +
allowed us to assume the possible association of PI3K with ROS
 +
production during rice seed germination.
 
===Evolution===
 
===Evolution===
 
Please input evolution information here.
 
Please input evolution information here.

Revision as of 07:09, 6 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Phosphatidylinositol 3-kinase (PI3K) has been reported to be important in normal plant growth and stress responses. In this study, it was verified that PI3K played a vital role in rice seed germination through regulating NADPH oxidase activity. Suppression of PI3K activity by inhibitors wortmannin or LY294002 could abate the reactive oxygen species (ROS) formation, which resulted in disturbance to the seed germination. And then, the signal cascades that PI3K promoted the ROS liberation was also evaluated. Diphenylene iodonium (DPI), an NADPH oxidase inhibitor, suppressed most of ROS generation in rice seed germination, which suggested that NADPH oxidase was the main source of ROS in this process. Pharmacological experiment and RT-PCR demonstrated that PI3K promoted the expression of Osrboh9. Moreover, functional analysis by native PAGE and the measurement of the 2, 3-bis-(2-methoxy-4-nitro-5-sulfophenyl)-2H-tetrazo-lium-5- carboxanilide (XTT) formazan concentration both showed that PI3K promoted the activity of NADPH oxidase. Furthermore, the western blot analysis of OsRac-1 demonstrated that the translocation of Rac-1 from cytoplasm to plasma membrane, which was known as a key factor in the assembly of NADPH oxidase, was suppressed by treatment with PI3K inhibitors, resulting in the decreased activity of NADPH oxidase. Taken together, these data favored the novel conclusion that PI3K regulated NADPH oxidase activity through modulating the recruitment of Rac-1 to plasma membrane and accelerated the process of rice seed germination

Expression

Changes of PI3K expression in rice seed after imbibition and the expression of PI3K is regulated by Ca2+. To determine the dynamic expression ofPI3Kin rice seed germination, the total RNA was extracted from the rice seed embryo after imbibition. The result of RT-PCR analysis suggested that PI3K might involve in the regulation of seed germination. Meanwhile, it was found that the expression ofPI3K was increased with the prolongation of imbibition time (Figure 1A).This expression peaked at 12 h and reached 30 times as many as seeds without treatment (Figure 1C). Interestingly, low concentration of Ca 2+(below10 mM) could further increase the expression of PI3Kin rice seeds after germinated for 12 h. However, when the concentration of Ca2+ was up to 20 mM, thePI3Kexpression began to decrease slightly compared with the treatment with 10 mM CaCl2(Figure 1B, D). LY294002 and Wortmannin inhibit rice seed germination Next, Wortmannin and LY294002, two kinds of PI3K inhibitors with different action mechanisms, were used to test the role of PI3K in the de-coated (without pericarp) rice seed germination [21]. Following treatment with 60mM LY294002 at 27uC for four days, the seed germination rate decreased to about 67.3% compared with the control. And it was further decreased to 54.0% when the concentration of LY294002 was increased to 90mM (Figure 2A). The seed germination rate was 55.7% of the control in the presence of 20mM Wortmannin and it would be decreased to 31.7% of the control with 30mM Wortmannin (Figure 2B). Dynamics of seed germination revealed that, relative to the control, 60 mM LY294002 or 20mM Wortmannin displayed both significant inhibitory effects on the seed germination at any time point (Figure 2C). From these results, we reasonably concluded that PI3K played a positive role in rice seed germination. LY294002 and Wortmannin inhibit ROS production PI3K inhibitors suppressed the ROS production in guard cell, root hair, and pollen tube [18,19,23]. However, it was uncertain that PI3K inhibitors restrained the ROS formation in rice seed germination. In our case, it was found that exogenous hydrogen peroxide (H2O2) could partly rescue the inhibitory effects of PI3K inhibitors on rice seed germination (Figure S1A). This finding allowed us to assume the possible association of PI3K with ROS production during rice seed germination.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os05g0465800

Description

Similar to RbohAp108

Version

NM_001062318.1 GI:115464366 GeneID:4339045

Length

4894 bp

Definition

Oryza sativa Japonica Group Os05g0465800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:22905974..22910867

Sequence Coding Region

22906100..22906400,22907201..22907363,22907440..22907488,22907582..22907695,22907768..22908190
,22908263..22908649,22908733..22908828,22908934..22909049,22909126..22909228
,22909348..22909436,22909542..22909692,22909773..22909922,22910013..22910141
,22910232..22910310,22910391..22910500

Expression

GEO Profiles:Os05g0465800

Genome Context

<gbrowseImage1> name=NC_008398:22905974..22910867 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:22905974..22910867 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgggggactacgtggacgtgccgctgggcggcggcgggcagagcacgctgccgccggtggcgccgctgaagaagcagccgtcgcggctggcgtccgggatgaagcggctggcgtccatggtgcccgacacgatgaagctgaagcggacgcactccagcgcgcagccggcgctgcgcggcctgcgcttcctcgacaagacgtcggcggggaaggacgggtggaagaacgtcgagaagcggttcgacgagatgagcgccgacggacgcctgccccaggagagcttcgccaaatgcatcggtatggcggattctaaggagtttgcaagcgaggtgtttgtggcattggcgagaaggaggagcatcaaaccagaagatgggataacaaaggaacagctgaaagaattttgggaggagttgactgatcagaactttgattcacgactacgaatattctttgacatgtgtgacaagaatggtgatgggcagcttacagaggacgaggtcaaagaggttattgtgttgagtgccgcagcaaacaaacttgccaagttgaaaagccatgctgcaacctacgcctcactgatcatggaagagctggatcctgatcatcgcggttacattgagatttggcagctggagacgctactccgtggtatggtgacagcccaagggcctccagagaaggtgaagctggcttcagcaagccttgcaaggacaatggtcccttccagtcaccggagtccaatgcagaggcgtttcaacaagactgttgacttcatccatgagaattggaagaggatatgggtgctctccttgtgggcgatcctcaatattgcattattcatgtacaagtttgtgcagtacagtaggcgggatgcatttcaggtgatgggctactgtgtctgcatagcaaagggtgctgccgaaacactcaagctgaacatggccgttatactcctcccggtgtgccgaaacacactaacaaggctccgatcaacagcactcagcaaagtcgtaccatttgatgataacataaacttccacaaggttatcgcactgacgattgcaattggagcggctactcatactcttgctcatgtaacctgcgacttcccaagattggtatcatgtccaagggacaagttcgaggccacactggggccttacttcaactatgttcaaccaacatactcatcgctggttgcaagcactccagggtggactggcatcctcatgatcttgataatgtcattctcgttcacacttgcgacacattcgttcaggaggagcgttgtgaagcttccatcaccactgcaccaccttgctggtttcaatgccttttggtacgcccatcacctactggtgattgcatatatcctcttggtgctgcactcctacttcatatttctcaccaagcagtggtacaatcgaacgacgtggatgttcttggcagttccagtcctcttttactcctgcgagagaactatcagaagagttcgtgagagcagttatggggtgaccgtcatcaaggcagcaatttaccctggaaatgtgctctctattcacatgaataaaccatcaagtttcaagtacaaaagtgggatgtatatgtttgtaaaatgcccagatgtttcgccttttgaatggcatcccttctccataacttctgcacctggagatgactacttgagtgttcatatccgtacattaggtgactggacaacagaacttagaaacctatttgggaaggcttgtgaggcacaagtaagttccaagaaggctacacttgcacgacttgaaaccactatcatagcagatggtctgaaagaggagacttgctttcccaaagtctttatagatggtcctttcggcgcaccagctcaaaattacaagaaatatgacattcttttgcttatcgggcttggaattggagcaacgcctttcatcagcatactgaaggatctcctgaacaacataaaatccaatggagatgtgcaaagcacgcatgatgctgagttaggctgcacctttaagagcaatgggccaggaagagcttatttctactgggtcaccagagagcaaggttcctttgaatggtttaaaggcgtgatgaatgatgttgctgaaagtgatcatgataatgtaatagagatgcacaattacctgacaagcgtgtatgaagaaggagatgcaagatcagctctgattgccatggtccaatcacttcaacatgccaaaaatggtgtggatatcgtctctggcagcaagatccggacacattttgcaaggccgaactggagaaaggtattctcagatctggccaatgcccaccagaactctcgtataggcgttttctactgtgggtctccaacacttacgaaaatgctgagggatctttcactagaattcagccagacgacaacgactcggttccatttccacaaggagaacttctaa</cdnaseq>

Protein Sequence

<aaseq>MAGDYVDVPLGGGGQSTLPPVAPLKKQPSRLASGMKRLASMVPD TMKLKRTHSSAQPALRGLRFLDKTSAGKDGWKNVEKRFDEMSADGRLPQESFAKCIGM ADSKEFASEVFVALARRRSIKPEDGITKEQLKEFWEELTDQNFDSRLRIFFDMCDKNG DGQLTEDEVKEVIVLSAAANKLAKLKSHAATYASLIMEELDPDHRGYIEIWQLETLLR GMVTAQGPPEKVKLASASLARTMVPSSHRSPMQRRFNKTVDFIHENWKRIWVLSLWAI LNIALFMYKFVQYSRRDAFQVMGYCVCIAKGAAETLKLNMAVILLPVCRNTLTRLRST ALSKVVPFDDNINFHKVIALTIAIGAATHTLAHVTCDFPRLVSCPRDKFEATLGPYFN YVQPTYSSLVASTPGWTGILMILIMSFSFTLATHSFRRSVVKLPSPLHHLAGFNAFWY AHHLLVIAYILLVLHSYFIFLTKQWYNRTTWMFLAVPVLFYSCERTIRRVRESSYGVT VIKAAIYPGNVLSIHMNKPSSFKYKSGMYMFVKCPDVSPFEWHPFSITSAPGDDYLSV HIRTLGDWTTELRNLFGKACEAQVSSKKATLARLETTIIADGLKEETCFPKVFIDGPF GAPAQNYKKYDILLLIGLGIGATPFISILKDLLNNIKSNGDVQSTHDAELGCTFKSNG PGRAYFYWVTREQGSFEWFKGVMNDVAESDHDNVIEMHNYLTSVYEEGDARSALIAMV QSLQHAKNGVDIVSGSKIRTHFARPNWRKVFSDLANAHQNSRIGVFYCGSPTLTKMLR DLSLEFSQTTTTRFHFHKENF</aaseq>

Gene Sequence

<dnaseqindica>127..427#1228..1390#1467..1515#1609..1722#1795..2217#2290..2676#2760..2855#2961..3076#3153..3255#3375..3463#3569..3719#3800..3949#4040..4168#4259..4337#4418..4527#tttcttcattggcctggaacgacgacgaccacgtacgccatggcgcccggggccacgctcctcctgcggtgagggcacccaccaccaccaccagcagcagcagcgggctacctagttcggatcaggatggcgggggactacgtggacgtgccgctgggcggcggcgggcagagcacgctgccgccggtggcgccgctgaagaagcagccgtcgcggctggcgtccgggatgaagcggctggcgtccatggtgcccgacacgatgaagctgaagcggacgcactccagcgcgcagccggcgctgcgcggcctgcgcttcctcgacaagacgtcggcggggaaggacgggtggaagaacgtcgagaagcggttcgacgagatgagcgccgacggacgcctgccccaggagagcttcgccaaatgcatcggtgagtgctcctgcacatgcccccatggtgttctccatcctccaaagtgattagtgattcaccacagcatgaaaagagagacggtgaaattgcattgttagcaagaacacatcgaaaattgacaagctttgttttccctgcaaaaaaaaaaggggaaaatgttgtcaaagcttttgtgcatgtgatggaaaaaggggaacagttagtagatgagaaattggtacagatcattcctagctcgtatgtcgatggtgtttgtccaaaatttcagccatttcaactgtttaagcagccagcctcctcctgccatccatgcatacatgtttgcagcacttctttgataaagtatacataatcattcctattcacaattttattttaacaaaaaacggaggaaagaaaattggaaaatttaagaggatataattggtcgaccacgggttgcacaaagttcagactttggcccccccaaatataactcggagacaatacttaccacgtagcaagaataggatatacttcctccgtttcataatgtaagactttcaatcattgcccacattcatatagatgttaatgaatctagacatatatatatgtgtatagattcattaacatctatatgaatatgggcaatgctagaaagtcttacaatatgaaacggagggagtactcgtgcttacgacattttcttttaaaagaagtgtagtcaggtaaataaatgacatcagaatagcaataaatccatcctctgtatataaattgaagctctaagcttagaatgcctctgcaacttaaaggtatggcggattctaaggagtttgcaagcgaggtgtttgtggcattggcgagaaggaggagcatcaaaccagaagatgggataacaaaggaacagctgaaagaattttgggaggagttgactgatcagaactttgattcacgactacgaatattctttgacatgtaaaggtctaccttccttgtcttcaatggaaaaaaccttatgacttgccccttgatgagattgctttgcaatcaggtgtgacaagaatggtgatgggcagcttacagaggacgaggtcaaagaggtcagttcccaatcatctctgaatttaccttttttccacaaagcttgtggaaatgatctcaataagaatttacctttctctttccatatgcaggttattgtgttgagtgccgcagcaaacaaacttgccaagttgaaaagccatgctgcaacctacgcctcactgatcatggaagagctggatcctgatcatcgcggttacattgaggtaccaagacatgaaattatctcccttttttttgacaaacagcagcatacagatatgcttgtctcaatgcagatttggcagctggagacgctactccgtggtatggtgacagcccaagggcctccagagaaggtgaagctggcttcagcaagccttgcaaggacaatggtcccttccagtcaccggagtccaatgcagaggcgtttcaacaagactgttgacttcatccatgagaattggaagaggatatgggtgctctccttgtgggcgatcctcaatattgcattattcatgtacaagtttgtgcagtacagtaggcgggatgcatttcaggtgatgggctactgtgtctgcatagcaaagggtgctgccgaaacactcaagctgaacatggccgttatactcctcccggtgtgccgaaacacactaacaaggctccgatcaacagcactcagcaaagtcgtaccatttgatgataacataaacttccacaaggtacacgtgtggaactctttgccatttccaggattacacagcctgacctctttgttctgatcaccatatcaggttatcgcactgacgattgcaattggagcggctactcatactcttgctcatgtaacctgcgacttcccaagattggtatcatgtccaagggacaagttcgaggccacactggggccttacttcaactatgttcaaccaacatactcatcgctggttgcaagcactccagggtggactggcatcctcatgatcttgataatgtcattctcgttcacacttgcgacacattcgttcaggaggagcgttgtgaagcttccatcaccactgcaccaccttgctggtttcaatgccttttggtacgcccatcacctactggtgattgcatatatcctcttggtgctgcactcctacttcatatttctcaccaagcagtggtacaatcgaacggtatttctctggcatatgtttggcacaactatttcttttgtgaattcagtggttgtgcataatattgacgcttgtgtttacagacgtggatgttcttggcagttccagtcctcttttactcctgcgagagaactatcagaagagttcgtgagagcagttatggggtgaccgtcatcaaggtaagcaacatatttcacatgaattgcacgatgagtattttcaatttattctagcttctaagtgtacaagaataccattaattgactatcaaatgtgccatgcaggcagcaatttaccctggaaatgtgctctctattcacatgaataaaccatcaagtttcaagtacaaaagtgggatgtatatgtttgtaaaatgcccagatgtttcgccttttgaatggtaccatctgatcgtctctgtccaaatgtcagtgtttatccaggctatggattaatagattcttcaatgcttccaggcatcccttctccataacttctgcacctggagatgactacttgagtgttcatatccgtacattaggtgactggacaacagaacttagaaacctatttgggaaggtcagttgagcaaacagaaacaaaaagaaaaggagaatagttcaggcataatgggagcttatgcagtatttatatgctaaattaacaaagttgctaaagggttatgctaattcatgcaggcttgtgaggcacaagtaagttccaagaaggctacacttgcacgacttgaaaccactatcatagcagatggtctgaaagaggagacttggtaattatgccctgtttgtttcatattctacattcatctactttttgaaggaatttctatacaattgtttcactaatcttcctgactttggttctcttcatttagctttcccaaagtctttatagatggtcctttcggcgcaccagctcaaaattacaagaaatatgacattcttttgcttatcgggcttggaattggagcaacgcctttcatcagcatactgaaggatctcctgaacaacataaaatccaatggagtaaactgcttaactatagcaaattctttcttatacagtaaaccaagtgcataatatctaaagtgaattggattcaacaggatgtgcaaagcacgcatgatgctgagttaggctgcacctttaagagcaatgggccaggaagagcttatttctactgggtcaccagagagcaaggttcctttgaatggtttaaaggcgtgatgaatgatgttgctgaaagtgatcatgatgtactactcagtctaactgcttcagtgcaacttccatgttctctccttcagattaataaatagatactaacataatcactcactatacagaatgtaatagagatgcacaattacctgacaagcgtgtatgaagaaggagatgcaagatcagctctgattgccatggtccaatcacttcaacatgccaaaaatggtgtggatatcgtctctggcagcaaggtttttcccacttctatcctcctgcaaaaataaaaataaaaactaaatcacatgtgcaaaatttgattcaatatttctcgctttatgcagatccggacacattttgcaaggccgaactggagaaaggtattctcagatctggccaatgcccaccagaactctcgtataggtcagttctatgtgataaatctcaagtgatggttcctagtttacaggatagcaatgctgagatgtttcataaatctgcaggcgttttctactgtgggtctccaacacttacgaaaatgctgagggatctttcactagaattcagccagacgacaacgactcggttccatttccacaaggagaacttctaagaccagaccaggaaaaaaacaccaaaataatcgcaggcgctcttatatagaacaagaaattttagcatcggttagcaactctttctgtgtaaagttccatcaagaactggaacattggtgtacaaaggtacgtgggcattagttagtgctgctgccgtttatagatggaggaaaaagaaaggcatgtattttctgagcaatttgattgtttcttagaatgtactagaaacaacgtgcggctttgccgcgcccaatttagattaggccaatctattttgtcagtggccttgtttaggatcaatggttttttttcttaacatattgaaccaaaaacctaaagaaataaattaatagacgttgggacttg</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0465800, RefSeq:Os05g0465800