Difference between revisions of "Os08g0103900"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Labs working on this gene)
Line 17: Line 17:
 
==Labs working on this gene==
 
==Labs working on this gene==
 
Please input related labs here.
 
Please input related labs here.
 +
1. Bioscience and Biotechnology Center, Nagoya University, Nagoya, Aichi, Japan
 +
2.Genome Resource Unit, National Institute of Agrobiological Sciences, Kannondai 2-1-2, Tsukuba, Ibaraki 305-8602, Japan
 +
3.Mitsubishi Space Software Co. Ltd., Takezono 1-6-1, Tsukuba, Ibaraki 305-0032, Japan
  
 
==References==
 
==References==

Revision as of 08:49, 6 June 2014

Please input one-sentence summary here.

Annotated Information

a NAM-like protein gene, Also a gene of NAC family.the last intron and exon of this gene overlaps with the first exon of a BTP/POZ domain-containing protein (Os08g0103600) gene. RNAi (RNA interference) pathway controls gene Os08g0103900 as well as gene Os08g0103600

Function

Please input function information here. gene Os08g0103900 ia a gene of the five clades containing rice andArabidopsiscell wall-associated genes,it shown to functionally complement the Arabidopsis snd1/nst1 double mutant with the nother two homologous rice NACs (Os06g0131700 and Os06g0104200).

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here. 1. Bioscience and Biotechnology Center, Nagoya University, Nagoya, Aichi, Japan 2.Genome Resource Unit, National Institute of Agrobiological Sciences, Kannondai 2-1-2, Tsukuba, Ibaraki 305-8602, Japan 3.Mitsubishi Space Software Co. Ltd., Takezono 1-6-1, Tsukuba, Ibaraki 305-0032, Japan

References

[1] "Oryza sativa nipponbare(GA3) genomic DNA, chromosome 8, PAC clone:P0015C07."Sasaki T., Matsumoto T., Yamamoto K.Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases

[2] "Collection, Mapping, and Annotation of Over 28,000 cDNA Clones from japonica Rice."Kikuchi S., Satoh K., Nagata T., Kawagashira N. Science 301:376-379(2003)

[3] "The map-based sequence of the rice genome."International rice genome sequencing project (IRGSP) Nature 436:793-800(2005)

[4] "The map-based sequence of the rice genome."International Rice Genome Sequencing Project Matsumoto T., Wu J., Kanamori H., Katayose Y., Fujisawa M.Nature 436:793-800(2005)

[5] "The Rice Annotation Project Database (RAP-DB): 2008 update."The Rice Annotation Project (RAP)Tanaka T., Antonio B.A., Kikuchi S., Matsumoto T. Nucleic Acids Res. 36:D1028-D1033(2008)

[6] "The rice annotation project database (RAP-DB): 2008 update."The rice annotation project (RAP) Nucleic Acids Res. 36:D1028-D1033(2008) [7] "Transcriptional Activation of Secondary Wall Biosynthesis by Rice and Maize NAC and MYB Transcription Factors."Zhong R., Lee C., McCarthy R.L., Reeves C.K.

Structured Information

Gene Name

Os08g0103900

Description

Similar to NAM-like protein

Version

NM_001067310.1 GI:115474356 GeneID:4344435

Length

1990 bp

Definition

Oryza sativa Japonica Group Os08g0103900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:209422..211411

Sequence Coding Region

209881..210386,210500..210787,210912..211092

Expression

GEO Profiles:Os08g0103900

Genome Context

<gbrowseImage1> name=NC_008401:209422..211411 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:209422..211411 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggatcggcatgaggaggaggcaggagagtctccatgtgtgccgccggggttcaggtttcacccgacggaggaggagctggtgggctactacctcgccaggaaggtggcctcccagaagatcgatctcgacatcatccaggagctcgatctctacaggatcgagccatgggatctgcaagagcgttgcaagtacggtgggcatggcggcgatgagcagacggagtggtacttcttcagctacaaggaccgcaagtaccccagcgggacgaggaccaaccgcgccacggcggcgggcttctggaaggccaccggccgcgacaagccggtgctctcgtcgccgtcgacgagggtgatcgggatgaggaagacgctggtgttctacaagggtcgcgcccccaacggccggaagaccgactggatcatccacgagtaccgcctccaatcaaacgaacacgcccctactcaggaggaaggttgggtggtttgccgcgcgtttcagaagccgatgcccaaccagcagcagcacaggctgtcctacggctgcatccccggcagctacggcgccggagcctacgccgccgtccccgacaactacagcttgctgctgcaccacgacaaccctagcttcgccgggcggccattgatgagcgccgctgcctcagctctcttcgccaacaacaacaataacagcgtcgtcgaccacagcaacattctgagttcagagtccaagcttcacttctccgacatgatgccgcctctggagagccccaccatcgtcgacggcgagggctacgtctcgcaggctagcagctgcgtcgacgtcgatcagcaagccggcatcgtcgactggaacctgctcaccagcttgctgccgccgccggcgcatcagctcttccaccacctgccttccgcttctagctccaagaacagcaacaacatttcttcgtcaggcttcatcgatgaccgagactga</cdnaseq>

Protein Sequence

<aaseq>MDRHEEEAGESPCVPPGFRFHPTEEELVGYYLARKVASQKIDLD IIQELDLYRIEPWDLQERCKYGGHGGDEQTEWYFFSYKDRKYPSGTRTNRATAAGFWK ATGRDKPVLSSPSTRVIGMRKTLVFYKGRAPNGRKTDWIIHEYRLQSNEHAPTQEEGW VVCRAFQKPMPNQQQHRLSYGCIPGSYGAGAYAAVPDNYSLLLHHDNPSFAGRPLMSA AASALFANNNNNSVVDHSNILSSESKLHFSDMMPPLESPTIVDGEGYVSQASSCVDVD QQAGIVDWNLLTSLLPPPAHQLFHHLPSASSSKNSNNISSSGFIDDRD</aaseq>

Gene Sequence

<dnaseqindica>1026..1531#625..912#320..500#atccagatgcgcttgcacttgcacttgcatgcagttcattgctctagctataggctatagctactatacactcatgagaatctgagattgggctgaaaattgatgagcatcgatctgaagaagacatatatatagctgatgatgatatagctttttctgcatatgcttgttttgatctgcagccaatcgatcgaggcatagagagtcaccaggcaatcaaattccaaccatccatcagctagatatatatacagcaaagatcacgatactcctagctagctagctagaagaattgatcggtcgatcggaggaaatagcaatggatcggcatgaggaggaggcaggagagtctccatgtgtgccgccggggttcaggtttcacccgacggaggaggagctggtgggctactacctcgccaggaaggtggcctcccagaagatcgatctcgacatcatccaggagctcgatctctacaggatcgagccatgggatctgcaaggtacgtactgatccattacattaaataaaccatgcattctattcatgcataattaatatcaattcagcaattaatttgggaactgaacgatcgatgattctgatgaattatatatatgtggcagagcgttgcaagtacggtgggcatggcggcgatgagcagacggagtggtacttcttcagctacaaggaccgcaagtaccccagcgggacgaggaccaaccgcgccacggcggcgggcttctggaaggccaccggccgcgacaagccggtgctctcgtcgccgtcgacgagggtgatcgggatgaggaagacgctggtgttctacaagggtcgcgcccccaacggccggaagaccgactggatcatccacgagtaccgcctccaatcaaacgaacacgcccctactcaggcatgcattgcaaccacctattccattccatcttaattttttacttctttacttaattatctgtcctactatatatgttaattcatggatattaatatggaatatggatgcaggaggaaggttgggtggtttgccgcgcgtttcagaagccgatgcccaaccagcagcagcacaggctgtcctacggctgcatccccggcagctacggcgccggagcctacgccgccgtccccgacaactacagcttgctgctgcaccacgacaaccctagcttcgccgggcggccattgatgagcgccgctgcctcagctctcttcgccaacaacaacaataacagcgtcgtcgaccacagcaacattctgagttcagagtccaagcttcacttctccgacatgatgccgcctctggagagccccaccatcgtcgacggcgagggctacgtctcgcaggctagcagctgcgtcgacgtcgatcagcaagccggcatcgtcgactggaacctgctcaccagcttgctgccgccgccggcgcatcagctcttccaccacctgccttccgcttctagctccaagaacagcaacaacatttcttcgtcaggcttcatcgatgaccgagactgatcgatcgatccagatcgattattatcaattgacaattcattcatcatatatatgcatgaattcttacaaatacgcacaattaaacgatcgagtgtactattaattagttgattactccgtctccatgatgtatacattaatttgaccactggccatcatcaggccatctgcatgcttactatctagcttatgtcagtacacggttgttagttcattcttaattaattagctactagtgtcagtgtgtgtatctatcggttgttcgtcttttgacctcattgctgagagaggtttgtaactgatgatgattaagttagctagcatttaattaggtgctatatatacacatatatatgcactatcactatatacatcatatatatgtatacatatatcgttgtctgcttaatgtgtacaccacctctctgcagtatatatagtattgatcaattaatttgt</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0103900, RefSeq:Os08g0103900