Difference between revisions of "Os01g0578500"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Annotated Information)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Most indica cultivars
+
Sterility is common in hybrids between divergent populations,such as the indica and japonica subspecies of Asian cultivated rice(Oryza sativa).SaF is one gene of the Sa locus,which include two adjacent genes SaF and SaM.SaM encoding a small ubiquitin-like modifier E3 ligase-like protein and an F-box protein. Most indica cultivars
contain a haplotype SaM�SaF�, whereas all japonica cultivars have
+
contain a haplotype SaM+SaF+,whereas all japonica cultivars have SaM-SaF- that diverged by nucleotide variations in wild rice. Male semi-sterility in this heterozygous complex locus is caused by abortion of pollen carrying SaM-. This allele-specific gamete elimination results from a selective interaction of SaF+ with SaM-, a truncated protein, but not with SaM+ because of the presence of an inhibitory domain, although SaM+ is required for this male sterility. Lack of any one of the three alleles in recombinant plants does not produce male sterility.
SaM�SaF� that diverged by nucleotide variations in wild rice. Male
 
semi-sterility in this heterozygous complex locus is caused by
 
abortion of pollen carrying SaM�. This allele-specific gamete elimination
 
results from a selective interaction of SaF� with SaM�, a
 
truncated protein, but not with SaM� because of the presence of
 
an inhibitory domain, although SaM� is required for this male
 
sterility. Lack of any one of the three alleles in recombinant plants
 
does not produce male sterility.
 
  
 
===Expression===
 
===Expression===

Revision as of 09:04, 6 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Sterility is common in hybrids between divergent populations,such as the indica and japonica subspecies of Asian cultivated rice(Oryza sativa).SaF is one gene of the Sa locus,which include two adjacent genes SaF and SaM.SaM encoding a small ubiquitin-like modifier E3 ligase-like protein and an F-box protein. Most indica cultivars contain a haplotype SaM+SaF+,whereas all japonica cultivars have SaM-SaF- that diverged by nucleotide variations in wild rice. Male semi-sterility in this heterozygous complex locus is caused by abortion of pollen carrying SaM-. This allele-specific gamete elimination results from a selective interaction of SaF+ with SaM-, a truncated protein, but not with SaM+ because of the presence of an inhibitory domain, although SaM+ is required for this male sterility. Lack of any one of the three alleles in recombinant plants does not produce male sterility.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0578500

Description

Cyclin-like F-box domain containing protein

Version

NM_001185502.1 GI:297720138 GeneID:9266343

Length

1733 bp

Definition

Oryza sativa Japonica Group Os01g0578500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:24032420..24034152

Sequence Coding Region

24032420..24033334,24033421..24033564,24033781..24034152

Expression

GEO Profiles:Os01g0578500

Genome Context

<gbrowseImage1> name=NC_008394:24032420..24034152 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:24032420..24034152 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggaggcggtcatcgcggagtgccgccccaagcctctcttcaccaccgggcccttcctctccgccgtcggcggcggcggcggcggcgtcgaccgcatctccgggctccccgacgacctcctctttgtcatcctctccaagctccccgtcagggatgccgtggcgacgtccgccctctccccccgctggaagagcctctggtccagcgtcccgctccgcctcgacgacgccggcctcctccaccgccgcgacggcacgcgcctcggccgggaaggcgtcgccgccaccgtctccgccgtcctcgccgcccacccaggccccgtgcccgcggcctccgttgggtgctgcctctcctccgacgaccagggctaccagctgggaggctggctccgagccctcgccgccaagggcgttcggcaactgtgcctgatgggcgcgccatggtcgccgcgcgctgctctcccctccgctgtgttctcctgctcatccctgcggcgcctcttccttggttccgtgcaatgcaactgggacctcataccagaccatgcctgcttccctgagctacgagagatccagatatgcaacgccctaatgaagagccaggatctgtcccttgttttggctgtctgcccagcgcttgagacagtggagattcttgcgagccgtaacaaaatccccaccgtgcgaatgagtagccatactatccgcaatactttgctatggaagtcggtggccaaggaagtgaacgttttggacaccccttgcctcagcagggttgttttgtggcaggatcttctgctgccccactcaagatataattctaaggtcacaatcagccgtgccaccaaaatgcgcatttccggttacctggacaccggcatcaacactttggtgatcaacgaaaccacagttaaggtaaacacaaatataagcttcaagacacttatccccagcgtgaaggttttgggtctctctgttcatttcggagtacgaaaggaggctttgatgtccatcagcttccttaggtgttttccagaggttgagacactacatataactagcaaaacggacaaggcttcagaagccgaacaattcagtttctggggaaaggttgatcctgttgagtgtgtgacctctcatctcaagaagttagtgttccatgggatgccatggtgtcctggaaaccttgagtttctcaaattcatcgtggaaggggcatacttgctagagaaggtgttgattgttcttcctaaaggaacttacactagcatgcatagcgttatcaccaaactcaagttagcacctttgacctctgcaagttgggctagtcacatctgtaaaatggaggttgtccaatccagtcaaggaactttgagctaccaaagggcatctgatcattccgtcgatgatcctttagattattccctgtag</cdnaseq>

Protein Sequence

<aaseq>MEAVIAECRPKPLFTTGPFLSAVGGGGGGVDRISGLPDDLLFVI LSKLPVRDAVATSALSPRWKSLWSSVPLRLDDAGLLHRRDGTRLGREGVAATVSAVLA AHPGPVPAASVGCCLSSDDQGYQLGGWLRALAAKGVRQLCLMGAPWSPRAALPSAVFS CSSLRRLFLGSVQCNWDLIPDHACFPELREIQICNALMKSQDLSLVLAVCPALETVEI LASRNKIPTVRMSSHTIRNTLLWKSVAKEVNVLDTPCLSRVVLWQDLLLPHSRYNSKV TISRATKMRISGYLDTGINTLVINETTVKVNTNISFKTLIPSVKVLGLSVHFGVRKEA LMSISFLRCFPEVETLHITSKTDKASEAEQFSFWGKVDPVECVTSHLKKLVFHGMPWC PGNLEFLKFIVEGAYLLEKVLIVLPKGTYTSMHSVITKLKLAPLTSASWASHICKMEV VQSSQGTLSYQRASDHSVDDPLDYSL</aaseq>

Gene Sequence

<dnaseqindica>1..915#1002..1145#1362..1733#atggaggcggtcatcgcggagtgccgccccaagcctctcttcaccaccgggcccttcctctccgccgtcggcggcggcggcggcggcgtcgaccgcatctccgggctccccgacgacctcctctttgtcatcctctccaagctccccgtcagggatgccgtggcgacgtccgccctctccccccgctggaagagcctctggtccagcgtcccgctccgcctcgacgacgccggcctcctccaccgccgcgacggcacgcgcctcggccgggaaggcgtcgccgccaccgtctccgccgtcctcgccgcccacccaggccccgtgcccgcggcctccgttgggtgctgcctctcctccgacgaccagggctaccagctgggaggctggctccgagccctcgccgccaagggcgttcggcaactgtgcctgatgggcgcgccatggtcgccgcgcgctgctctcccctccgctgtgttctcctgctcatccctgcggcgcctcttccttggttccgtgcaatgcaactgggacctcataccagaccatgcctgcttccctgagctacgagagatccagatatgcaacgccctaatgaagagccaggatctgtcccttgttttggctgtctgcccagcgcttgagacagtggagattcttgcgagccgtaacaaaatccccaccgtgcgaatgagtagccatactatccgcaatactttgctatggaagtcggtggccaaggaagtgaacgttttggacaccccttgcctcagcagggttgttttgtggcaggatcttctgctgccccactcaagatataattctaaggtcacaatcagccgtgccaccaaaatgcgcatttccggttacctggacaccggcatcaacactttggtgatcaacgaaaccacagttaaggtatttgtccctttgttggatatatatctctaatcatatcgaatctgtgaaactgtgttaacgcgttttaatcgttgaatttgaaggtaaacacaaatataagcttcaagacacttatccccagcgtgaaggttttgggtctctctgttcatttcggagtacgaaaggaggctttgatgtccatcagcttccttaggtgttttccagaggttgagacactacatataactgtgagatttctttccttctttcattcccgacatatatatacataaatgtgagattgcgagatagctgtctttcttctttcattcctgacatatgcatcattttacacactcactgcagccattctttcattcccgacatatgcatcattttacacactcactgcagccatatgttcctttgatagctggaggtgatcaatttttcttcttgtgcagagcaaaacggacaaggcttcagaagccgaacaattcagtttctggggaaaggttgatcctgttgagtgtgtgacctctcatctcaagaagttagtgttccatgggatgccatggtgtcctggaaaccttgagtttctcaaattcatcgtggaaggggcatacttgctagagaaggtgttgattgttcttcctaaaggaacttacactagcatgcatagcgttatcaccaaactcaagttagcacctttgacctctgcaagttgggctagtcacatctgtaaaatggaggttgtccaatccagtcaaggaactttgagctaccaaagggcatctgatcattccgtcgatgatcctttagattattccctgtag</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0578500, RefSeq:Os01g0578500