Difference between revisions of "OrfB"
(→Expression) |
(→Evolution) |
||
| Line 25: | Line 25: | ||
You can also add sub-section(s) at will. | You can also add sub-section(s) at will. | ||
| + | orfB transcripts of the sterile line have identical 3’ ends | ||
| + | with that of transcripts from the fertile lines | ||
| + | The basis of the observed differences in the orfB gene | ||
| + | transcripts between the sterile and fertile lines was | ||
| + | determined using 3’ RACE. The forward primer OGSP1 | ||
| + | (Figure 4) annealed 180 bp downstream of the | ||
| + | initiation codon in the coding region of the orfB gene. | ||
| + | In both the fertile and sterile rice lines, one amplified | ||
| + | band of ~400 bp was obtained | ||
==Labs working on this gene== | ==Labs working on this gene== | ||
Revision as of 11:11, 6 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here. The editing of the orfB gene ~1.1 kb transcript co-segregated with fertility restoring alleles in a segregating population of F2 progeny of restored hybrid F1 plants.
Expression
Please input expression information here. Editing of the orfB transcripts (a) The fertile line Mitochondrial RNA editing of the orfB transcript was assessed in the fertile rice line. Fourteen cDNA clones obtained from cDNA library of fertile rice line were sequenced. Determination of the orfB cDNA sequence from overlapping clones from the cDNA library showed four C®T conversions within the coding region relative to the orfB genomic sequence.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will. orfB transcripts of the sterile line have identical 3’ ends with that of transcripts from the fertile lines The basis of the observed differences in the orfB gene transcripts between the sterile and fertile lines was determined using 3’ RACE. The forward primer OGSP1 (Figure 4) annealed 180 bp downstream of the initiation codon in the coding region of the orfB gene. In both the fertile and sterile rice lines, one amplified band of ~400 bp was obtained
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
| Gene Name |
orfB |
|---|---|
| Description |
ORFB protein |
| Version |
GeneID:6450152 |
| Length |
468 bp |
| Definition |
Oryza sativa Japonica Group orfB, Mitochondrion gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Mitochondrion:53424..53891 |
| Sequence Coding Region |
53424..53891 |
| Genome Context |
<gbrowseImage3> name=NC_011033:53424..53891 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage3> |
| Gene Structure (RNA Editing) |
<gbrowseImage2> name=NC_011033:53424..53891 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage2> |
| Protein Sequence |
<aaseq>MPQLDKLTYFSQFFWLCLFFFSFYILLLNNNNGILGISRILKLRNQLLSHRGNKIRFKDPKNLEDILRKGFSTGLSYMYSSLSEVSQWCKTVDYLGKRRKITLISDFGEISGSRGMERQILYLISKSSYNTSSSRITCWKKIMLTHVLHGQGSII</aaseq> |
| Gene Sequence |
<dnaseqindica>1..468#atgcctcaacttgataaattgacttatttctcacaattcttctggttatgccttttcctctttagtttttatattctcttattaaataataataatggaatacttggaattagcagaattctcaaactacggaaccaactgctttcgcaccgggggaacaagatccgtttcaaggaccctaagaatttggaagatatctcgagaaaaggttttagcaccggtctctcatatatgtactccagtttatccgaagtatcccaatggtgtaagaccgtcgactatttgggaaaaaggaggaaaatcactctgatctcagatttcggagaaataagtggctcacgaggaatggagagacagattctctatttgatctcgaagtcctcatataacacttcttccagtcggatcacttgttggaaaaaaataatgctcacacatgttccacacgggcaaggaagcataatctaa</dnaseqindica> |
| External Link(s) |
