Difference between revisions of "Os06g0211200"
| Line 1: | Line 1: | ||
| − | + | Os06g0211200, encoding a gene named OsAREB1(an ABRE-binding protein responding to ABA and glucosemay), function as a positive regulator in drought/heat stresses response, but a negative regulator in flowering time in Arabidopsis. | |
==Annotated Information== | ==Annotated Information== | ||
| Line 10: | Line 10: | ||
===Expression=== | ===Expression=== | ||
Expression patterns of the OsAREB1 gene under various environmental stresses and hormones were analyzed by RT-PCR. | Expression patterns of the OsAREB1 gene under various environmental stresses and hormones were analyzed by RT-PCR. | ||
| − | OsAREB1 gene was induced within 1 or 2 h under 100 μM ABA and 15% PEG 6,000 treatments, and maintained the expression level for at least 8 hours. It’s expression was induced by heat within 1 h, and rapidly reached the top expression level within 2 h, then declined to initial level | + | OsAREB1 gene was induced within 1 or 2 h under 100 μM ABA and 15% PEG 6,000 treatments, and maintained the expression level for at least 8 hours. It’s expression was induced by heat within 1 h, and rapidly reached the top expression level within 2 h, then declined to initial level. |
OsAREB1 was not induced by KT, MeJA, NaCl and cold .These results indicated that OsAREB1was induced by exogenous ABA, water stress and heat. This result | OsAREB1 was not induced by KT, MeJA, NaCl and cold .These results indicated that OsAREB1was induced by exogenous ABA, water stress and heat. This result | ||
was consistent with the report of Lu et al. (17). | was consistent with the report of Lu et al. (17). | ||
| Line 18: | Line 18: | ||
Please input evolution information here. | Please input evolution information here. | ||
| + | Extending Knowledge | ||
===Binding activity=== | ===Binding activity=== | ||
OsAREB1 has ABRE-binding activity in yeast | OsAREB1 has ABRE-binding activity in yeast | ||
| Line 40: | Line 41: | ||
β-galactosidase activity was performed. Compared to the negative control, the relative β-galactosidase activity of the transformants was about four (Fig. 1C), which revealed there’s a distinct enhancement for β-galactosidase activity. | β-galactosidase activity was performed. Compared to the negative control, the relative β-galactosidase activity of the transformants was about four (Fig. 1C), which revealed there’s a distinct enhancement for β-galactosidase activity. | ||
| − | + | [[File:Example.jpg]] | |
| Line 46: | Line 47: | ||
==Labs working on this gene== | ==Labs working on this gene== | ||
| − | + | 1 | |
| + | Biotechnology Research Institute, Shanghai Academy of Agricultural Sciences, Shanghai, | ||
| + | 2 | ||
| + | College of Life Science and Technology, | ||
| + | Yangzhou University, Jiangsu, PR China | ||
==References== | ==References== | ||
| − | + | Lu, G. J., Gao, C. X., Zheng, X. N. and Han, B. (2009) | |
| + | Identification of OsbZIP72 as a positive regulator of ABA | ||
| + | response and drought tolerance in rice. Planta 229, | ||
| + | 605-615. | ||
| + | |||
| + | Jin XF1, Xiong AS, Peng RH, Liu JG, Gao F, Chen JM, Yao QH. (2010) | ||
| + | OsAREB1, an ABRE-binding protein responding to ABA and glucose, has multiple functions in Arabidopsis. | ||
| + | BMB Rep 43(1):34-9. | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 14:05, 6 June 2014
Os06g0211200, encoding a gene named OsAREB1(an ABRE-binding protein responding to ABA and glucosemay), function as a positive regulator in drought/heat stresses response, but a negative regulator in flowering time in Arabidopsis.
Contents
Annotated Information
Function
Firstly, Overexpression of OsAREB1alters seedling sensitivity to ABA and glucose. Secondly, Enhanced tolerance of 35S-OsAREB1plants to drought and heat. Thirdly, OsAREB1 delay the flowering time.
Expression
Expression patterns of the OsAREB1 gene under various environmental stresses and hormones were analyzed by RT-PCR. OsAREB1 gene was induced within 1 or 2 h under 100 μM ABA and 15% PEG 6,000 treatments, and maintained the expression level for at least 8 hours. It’s expression was induced by heat within 1 h, and rapidly reached the top expression level within 2 h, then declined to initial level. OsAREB1 was not induced by KT, MeJA, NaCl and cold .These results indicated that OsAREB1was induced by exogenous ABA, water stress and heat. This result was consistent with the report of Lu et al. (17).
Evolution
Please input evolution information here.
Extending Knowledge
Binding activity
OsAREB1 has ABRE-binding activity in yeast Blast result indicated that OsAREB1 belongs to ABF subfamily. Most members of this subfamily can bind to the ABRE cis-element with a core sequence ACGTGCC. Yeast one-hybrid system was used to determine the DNA-binding activity of OsAREB1 with ABRE element. The entire coding region of OsAREB1 was fused to the GAL4 transcription active domain (TA). The construct was transformed into yeast (EGY48) harboring ABRE sequence fused upstream of a lacZreporter gene, and the growth status of transformants was observed. Yeast cells harboring pPC86 and G222 could grow on SD medium lacking Trp, while cells only with G222 could not grow on the selection medium (Fig. 1A). The colony-lift filter assay suggested that OsAREB1 can bind to the ABRE cis-element. Shown as Fig. 1B, when the colony grew on X-gal containing plate, only cells with pPC86-OsAREB1 and G222 turned blue, cells only with G222 or with both G222 and pPC86 did not turn blue. This result indicated that only OsAREB1 can bind to the ABRE cis-element and then active the expression of lacZ gene. Further, quantificational analysis for β-galactosidase activity was performed. Compared to the negative control, the relative β-galactosidase activity of the transformants was about four (Fig. 1C), which revealed there’s a distinct enhancement for β-galactosidase activity.
You can also add sub-section(s) at will.
Labs working on this gene
1 Biotechnology Research Institute, Shanghai Academy of Agricultural Sciences, Shanghai, 2 College of Life Science and Technology, Yangzhou University, Jiangsu, PR China
References
Lu, G. J., Gao, C. X., Zheng, X. N. and Han, B. (2009)
Identification of OsbZIP72 as a positive regulator of ABA response and drought tolerance in rice. Planta 229, 605-615.
Jin XF1, Xiong AS, Peng RH, Liu JG, Gao F, Chen JM, Yao QH. (2010) OsAREB1, an ABRE-binding protein responding to ABA and glucose, has multiple functions in Arabidopsis. BMB Rep 43(1):34-9.
Structured Information
| Gene Name |
Os06g0211200 |
|---|---|
| Description |
Similar to Abscisic acid responsive elements-binding factor (ABA-responsive element binding protein 1) (AREB1) |
| Version |
NM_001063653.1 GI:115467037 GeneID:4340462 |
| Length |
4829 bp |
| Definition |
Oryza sativa Japonica Group Os06g0211200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:5676158..5680986 |
| Sequence Coding Region |
5676361..5677152,5677846..5677917,5678514..5678543,5680499..5680575,5680665..5680668 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008399:5676158..5680986 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008399:5676158..5680986 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggagttgccggcggatgggagcgcgctggcgaggcaggggtcgatctactcgctgacgttcgacgagttccagagcgcgctgggaagcgccgagaaggatttcgggtcgatgaacatggatgagctgctgcgcaacatctggacggcggaggagtcgcaggccatagcgccggcggcggcggctgcttcggcggcggcggtggttggggacgcgcagcagcagcagcagccgatccagaggcaggggtcgctgacgctgccacgcacgctgagccagaagacggtggacgaggtgtggcgcgacatcatgggcttgggcggcagcgacgacgaagaccccgcggcggcggcggctgcggcggcgcccgcgcagcggcagccgacgctgggggagatgacgctggaggagttcctggtgcgggccggcgtcgtgcgggaggacatggggcagaccatcgtgctgccgccgcaggcgcaggcgttgttccccgggagcaatgtggtcgccccggccatgcagctcgccaacgggatgctgcctggtgtcgtcggcgtcgcccccggcgccgccgccgcgatgacggtggcggcgccggccacgccggtggtgctgaacgggctggggaaggtggagggcggggatctctcgtcgctctcgccggtgccttacccattcgacaccgcgctcagggtgaggaagggccctaccgtcgagaaggtggtggagaggcggcagaggcggatgatcaagaacagggagtccgctgctaggtctcgcgcgcggaagcaggcttatataatggagttggaagctgaggtggcaaaactgaaggaacagaaggctgaattgcagaaaaagcaggtggaaatgatacagaagcaaaatgatgaggtcatggagagaatcactcagcaacttggaccaaaggcaaagagattttgcctccgacgaacactgactggtccatgctga</cdnaseq> |
| Protein Sequence |
<aaseq>MELPADGSALARQGSIYSLTFDEFQSALGSAEKDFGSMNMDELL RNIWTAEESQAIAPAAAAASAAAVVGDAQQQQQPIQRQGSLTLPRTLSQKTVDEVWRD IMGLGGSDDEDPAAAAAAAAPAQRQPTLGEMTLEEFLVRAGVVREDMGQTIVLPPQAQ ALFPGSNVVAPAMQLANGMLPGVVGVAPGAAAAMTVAAPATPVVLNGLGKVEGGDLSS LSPVPYPFDTALRVRKGPTVEKVVERRQRRMIKNRESAARSRARKQAYIMELEAEVAK LKEQKAELQKKQVEMIQKQNDEVMERITQQLGPKAKRFCLRRTLTGPC</aaseq> |
| Gene Sequence |
<dnaseqindica>204..995#1689..1760#2357..2386#4342..4418#4508..4511#gattaaacctgatttccccttgctaattcgggccatcgcatcactcccccaactaatcacactcctctcttctccgcttcctcttctcgtatatttataaccccacttcccttttcttcctctttcttctcatcttggtttcttcctagtttcgggagaggattttagtgagggatttgaaggattttgaggtgggagaggagatggagttgccggcggatgggagcgcgctggcgaggcaggggtcgatctactcgctgacgttcgacgagttccagagcgcgctgggaagcgccgagaaggatttcgggtcgatgaacatggatgagctgctgcgcaacatctggacggcggaggagtcgcaggccatagcgccggcggcggcggctgcttcggcggcggcggtggttggggacgcgcagcagcagcagcagccgatccagaggcaggggtcgctgacgctgccacgcacgctgagccagaagacggtggacgaggtgtggcgcgacatcatgggcttgggcggcagcgacgacgaagaccccgcggcggcggcggctgcggcggcgcccgcgcagcggcagccgacgctgggggagatgacgctggaggagttcctggtgcgggccggcgtcgtgcgggaggacatggggcagaccatcgtgctgccgccgcaggcgcaggcgttgttccccgggagcaatgtggtcgccccggccatgcagctcgccaacgggatgctgcctggtgtcgtcggcgtcgcccccggcgccgccgccgcgatgacggtggcggcgccggccacgccggtggtgctgaacgggctggggaaggtggagggcggggatctctcgtcgctctcgccggtgccttacccattcgacaccgcgctcagggtgaggaagggccctaccgtcgagaaggtggtggagaggcggcagaggcggatgatcaagaacagggagtccgctgctaggtctcgcgcgcggaagcaggtgaagcctctcttctcttcaactgcactaggatgtaggaatacgtagcaatcttatgtccatttgcttgattaattagttctgaaaattcgatggtgcctatatttggtatgcctctcgataatgctgtactttattcacatgatgtgatccccccacttctaattcagcttgtagatgttaatttatgcctaatagccactgcaaatagcaagttagcgtcgttaaatattgttcaaccacagaggataagaatctaaagtgaataagccatggttcaagttgatgctctcagattcagagagatgatgagtggctttgttcatttcgggacactggctgagcggtgtttttttttttttttggatcgactattgctgtgatagggatagcatgctcaccatgaagcttggaaggacaattgacaagaccaattcgagaaatagtaacttccgttgatcttttctttaaaaaaaaaacttgtgggggtaataggtcttttttatgtgcaagttgtgctgccatgatgcactcatacttctataaaagctagtatatacttttattgttctaacatagcaaggtcaagtctttctgatactctgattgacagagaatagttctagacagttatggttgtgttgcgaaacacaattttttaacattaaattttggctttctgatatacaacaggcttatataatggagttggaagctgaggtggcaaaactgaaggaacagaaggctgaattgcagaaaaagcaggtatacctgctgtcatataaaattgctttgatccatgcatactctttatttttttctgtttctcttaccaattcctgtaatcagttagtagtccttagataacctcttgactttggataattcctatgtttcttgcctcgattgtcatatttgtttggggatttgggcttaccaatggctgttgttttaatctacccccagcaatgcttgttgctggtattgcaatatgtaggtgaccacaaatagcattcaaatgtccttgttctatgtatttcctgtggaatttatctgagttcaaatctttaatggttgttggaggtttgcacttaaaaggtgtatccctttttaatttgaacattgatggggttacattaattttgtattactgtcctgcaaacttgtattgaaatcctatgccatctggtatcttcttgttcacacattttccatgtgcctactattgttatgccagtatgtcattgtatcatgattttgtaattgaataacttaacaaaagcaccaaaccttttcttcttccaaattcctgacaaaaaatccatgaagctttattcacttattatgcttctaatttgcaggtggaaatgatacagaagcaaaatgatgaggtaatgaccttacagttggtagtaaataccatggttctgaattcgcactatgtttgtcctcattgatgtggaagttgtctatacctctttttgatcataccatactttcttcttttttaaataaaaaacaagagtaagttcatttccacaaacttgctgattaagggatctttggatctgggtgaattttttggggcatttgcaagtttggactaaagttctgatgacttgaatccagataccctctatatccaaacagacccaaattggggcaaaacaacaagctaactctatcgaaccaattcgtttttcttgctgtgagcctttcctaaaactggcagacgccttagaatctccatggctgaagtttgtcaaagtgcacaacaacagtagcattaggtcatttattagagctgcatgacattcaaattctttttaatgagctgcacaacaacatgcacgatttcccaattctggctgtgaggtgtgtttgttattgcattttttgtggtcatgtcagaaaatatcttactacatatggtttaaattatgtttcagaaatcccttattctttaaccaactgccatcataaatgtatatgctggtgttggccatatatttcatgtcactgacactctggcctcttatcccttctcattttcattcatgtatcatgttatctatgtagggtcattgtgttacatccatcttcagttttttaacactttagtgccatccacttgtggttttttttttcataaaataaatttgaagaaactaacagagatatgcaatactggaactcctgccattgcaatagaaaattagcacatcatgattttcagctatcacagtgtggattactgtgatgtgttttttgttaaaaaaaaatgtacactactttgtcctacactcgtccctgctgtcaaataattgagtttgccatgtacagagtaaatgtccagatgtgcaccattctgaatatggtatcccattttgggcatgcatgcttgtaacaccaaaattctgttggagaacatactacccaataagctcaaggtttcattttcaaaatctagttatctgtaattcccatgtcattatagttaaagtatttaattttctaccttctgttttatttttaactaatcagttcaattttttaaccaaagaatgatactcttttaccagggagatctgaagtgacttattggacatacaatgctaaaacaacaaactaaaacaacaaaatggacattgggtaggtttgtctgggtggtatgctcaacccagtctgatctggagtattaaaaagaatcctgactctaaatttagtccaccgctactatagacgctatagtgagcctgtccagcattcaaattaaggacattagttgtgttcgtttctaatggttgggaaccttccccctctagcatgtaaaacggagcaacgatttagcacacgatcaattaagtattagctaaaaaaaacttgaaaaaatggattaatataattttttaaaccaacttttctatagaaagtttttctagaaaacacattgtttagcagttttggaagcgtgcgtgcggaaaacaagtgagtagaggtgggaaagtgtagggaagatgtcatgttggtttgaattttgaaagtctgcaaactcttactaatgttacataaatagttttggttgctactctgcggtttcaagcagtaaacctctgcctcaatcattctgaagtttaagcatttctttgattataatcagtacagttagaaggccttaactgggtgcatttttatgttccgacttctgacgatctcactgaaatctgacaagtgttttctagctgaagatagtacattttactagatgctttgcaatgttgagaaagttctcttcatagattcttctttccctaacaggagttttatctataaatggattttgcaggtcatggagagaatcactcagcaacttggaccaaaggcaaagagattttgcctccgacgaacactgactggtccatggtaagttgatcaagtttgcacagcattgaccaaagttaagatcgttggcttccttggatgtgaccaatcgccgcgtgtatatatatcagctgaagccagagtctccggtttcgccgtggcgctcagcttcagagttgcttctctccttgttggtgaatggtgatggctcagtctcttggacggtcgaatgctggcgtcgattactcactaggtttagctgcgagatcgttgcgtgagcaaaggcatactatctaatctgtttaactccttatttagggaaatctggcatggtgaaaacggggcatgccatctgtgtttgttgtttttgtgcagctgttgcatctgctctgtatgttgctgttgcgttgacatgtcatcccgtttacagttcagtgattctgttctgtaccc</dnaseqindica> |
| External Link(s) |
