Difference between revisions of "Os05g0522500"

From RiceWiki
Jump to: navigation, search
(Expression)
(References)
Line 16: Line 16:
 
Please input related labs here.
 
Please input related labs here.
  
==References==
+
1.Jung-Il Cho;Nayeon Ryoo;Joon-Seob Eom;Dae-Woo Lee;Hyun-Bi Kim;Seok-Won Jeong;Youn-Hyung Lee;Yong-Kook Kwon;Man-Ho Cho;Seong Hee Bhoo;Tae-Ryong Hahn;Youn-Il Park;Ildoo Hwang;Jen Sheen;Jong-Seong Jeon.Role of the Rice Hexokinases OsHXK5 and OsHXK6 as Glucose Sensors.Plant Physiology.2009, 149(2): 745-759
Please input cited references here.
+
2. Jung-Il Cho;Nayeon Ryoo;Seho Ko;Sang-Kyu Lee;Junok Lee;Ki-Hong Jung;Youn-Hyung Lee;Seong Hee Bhoo;Joris Winderickx;Gynheung An;Tae-Ryong Hahn;Jong-Seong Jeon.Structure, expression, and functional analysis of the hexokinase gene family in rice (Oryza sativa L.).Planta, 2006, 224(3): 598-611
  
 
==Structured Information==
 
==Structured Information==

Revision as of 15:20, 6 June 2014

Please input one-sentence summary here.

Annotated Information

Function

The Arabidopsis (Arabidopsis thaliana) hexokinase 1 (AtHXK1) is recognized as an important glucose (Glc) sensor. However, the function of hexokinases as Glc sensors has not been clearly demonstrated in other plant species, including rice (Oryza sativa). To investigate the functions of rice hexokinase isoforms, we characterized OsHXK5 and OsHXK6, which are evolutionarily related to AtHXK1. Transient expression analyses using GFP fusion constructs revealed that OsHXK5 and OsHXK6 are associated with mitochondria. Interestingly, the OsHXK5DmTP-GFP and OsHXK6DmTP-GFP fusion proteins, which lack N-terminal mitochondrial targeting peptides, were present mainly in the nucleus with a small amount of the proteins seen in the cytosol. In addition, the OsHXK5NLS-GFP and OsHXK6NLS-GFP fusion proteins harboring nuclear localization signals were targeted predominantly in the nucleus, suggesting that these OsHXKs retain a dual-targeting ability to mitochondria and nuclei. In transient expression assays using promoter::luciferase fusion constructs, these two OsHXKs and their catalytically inactive alleles dramatically enhanced the Glc-dependent repression of the maize (Zea mays) Rubisco small subunit (RbcS) and rice a-amylase genes in mesophyll protoplasts of maize and rice. Notably, the expression of OsHXK5, OsHXK6, or their mutant alleles complemented the Arabidopsis glucose insensitive2-1 mutant, thereby resulting in wild-type characteristics in seedling development, Glc-dependent gene expression, and plant growth. Furthermore, transgenic rice plants overexpressing OsHXK5 or OsHXK6 exhibited hypersensitive plant growth retardation and enhanced repression of the photosynthetic gene RbcS in response to Glc treatment. These results provide evidence that rice OsHXK5 and OsHXK6 can function as Glc sensors.

Expression

OsHXK5 cDNA full length 2058bp, contains nine exons encoding a 507 amino acid composition of hexokinase, OsHXK5 contain nuclear localization signal peptide, mitochondrial targeting signal peptide and sugar binding domain

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

1.Jung-Il Cho;Nayeon Ryoo;Joon-Seob Eom;Dae-Woo Lee;Hyun-Bi Kim;Seok-Won Jeong;Youn-Hyung Lee;Yong-Kook Kwon;Man-Ho Cho;Seong Hee Bhoo;Tae-Ryong Hahn;Youn-Il Park;Ildoo Hwang;Jen Sheen;Jong-Seong Jeon.Role of the Rice Hexokinases OsHXK5 and OsHXK6 as Glucose Sensors.Plant Physiology.2009, 149(2): 745-759 2. Jung-Il Cho;Nayeon Ryoo;Seho Ko;Sang-Kyu Lee;Junok Lee;Ki-Hong Jung;Youn-Hyung Lee;Seong Hee Bhoo;Joris Winderickx;Gynheung An;Tae-Ryong Hahn;Jong-Seong Jeon.Structure, expression, and functional analysis of the hexokinase gene family in rice (Oryza sativa L.).Planta, 2006, 224(3): 598-611

Structured Information

Gene Name

Os05g0522500

Description

Similar to Hexokinase 1 (EC 2.7.1.1)

Version

NM_001062617.1 GI:115464964 GeneID:4339361

Length

4934 bp

Definition

Oryza sativa Japonica Group Os05g0522500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:26078578..26083511

Sequence Coding Region

26078717..26079015,26080528..26080678,26080762..26080944,26081285..26081359,26081530..26081685
,26081820..26081918,26082002..26082132,26082622..26082703,26082796..26083143

Expression

GEO Profiles:Os05g0522500

Genome Context

<gbrowseImage1> name=NC_008398:26078578..26083511 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:26078578..26083511 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggaaggcggcggcggtggggacggcggtggtggtggccgcggcggtcggggtggcggtggtgctggcgcggaggcggaggaggagggacctggagctggtggagggagccgcggcggagaggaagaggaaggtggcggcggtgatcgaggacgtggagcacgcgctgtcgaccccgacggcgctgctgcggggcatctcggacgccatggtcaccgagatggagcgaggcctgcgcggggacagccacgccatggttaagatgctcatcacctacgtcgacaacctccccaccggaaatgaacaggggttgttttatgcattggatcttggaggaaccaacttccgcgtcctgcgagtccaactcggtggcaaggagaaacgtgtcgtccaacaacagtacgaggaagtctcaattccaccacatctgatggttggaacttccatggaactgtttgattttattgcttctgcattgtcaaaatttgttgatactgaaggtgatgatttccacctcccagaagggagacagagagagctgggcttcaccttttccttcccagtgagccagacatcaatatcgtcaggaacgctcatcaagtggacaaagggtttctccatcaatgacgcggttggcgaagatgttgtatctgagttgggcaaggccatggagaggcagggattagatatgaaaattgcagcattggttaatgacactgtcggcacattggctggtgggaggtatgcggataacagtgttgttgctgctataatattgggcactggtacaaatgcagcatatgttgagaatgctaatgcaattcctaaatggaccggtttactgcctaggtccggaaatatggtaatcaacacagaatgggggagctttaaatcagataagcttcctctttcagaattcgataaagcaatggattttgaaagcttgaatcctggagagcagatatatgaaaagttgatttctggcatgtatcttggagagatagtgcgaagaatcttgctgaagcttgctcatgatgcagctttgtttggggatgttgttccatctaagctagagcaaccgtttgtactaaggacaccggatatgtcagccatgcatcatgactcgtcacatgaccttaaaactgttggagctaagctaaaggatatcgtcggggtcccagatacttccctggaagtaagatacattaccagtcacatttgtgacatagttgcagagcgtgctgcacgcttggctgctgctggcatatatggggtcctaaagaagctaggtcgggacaagatgccaaaagacggcagtaagatgcctaggactgtcattgccttggatggtgggctctatgaacattacaagaagttcagcagttgcttagaatcaactctaacagaccttcttggggatgatgtctcgtcttcggtggttaccaagctggccaacgatggttctggcattggagctgctcttctcgcagcctcgcactcccagtatgccgagatcgactag</cdnaseq>

Protein Sequence

<aaseq>MGKAAAVGTAVVVAAAVGVAVVLARRRRRRDLELVEGAAAERKR KVAAVIEDVEHALSTPTALLRGISDAMVTEMERGLRGDSHAMVKMLITYVDNLPTGNE QGLFYALDLGGTNFRVLRVQLGGKEKRVVQQQYEEVSIPPHLMVGTSMELFDFIASAL SKFVDTEGDDFHLPEGRQRELGFTFSFPVSQTSISSGTLIKWTKGFSINDAVGEDVVS ELGKAMERQGLDMKIAALVNDTVGTLAGGRYADNSVVAAIILGTGTNAAYVENANAIP KWTGLLPRSGNMVINTEWGSFKSDKLPLSEFDKAMDFESLNPGEQIYEKLISGMYLGE IVRRILLKLAHDAALFGDVVPSKLEQPFVLRTPDMSAMHHDSSHDLKTVGAKLKDIVG VPDTSLEVRYITSHICDIVAERAARLAAAGIYGVLKKLGRDKMPKDGSKMPRTVIALD GGLYEHYKKFSSCLESTLTDLLGDDVSSSVVTKLANDGSGIGAALLAASHSQYAEID</aaseq>

Gene Sequence

<dnaseqindica>140..438#1951..2101#2185..2367#2708..2782#2953..3108#3243..3341#3425..3555#4045..4126#4219..4566#ctttctcctacgcggccggagagaggaggggggaagagaggatctcgcagagcgccatagcctcggatccagaagcggaattcggtggaggtctcgggcacctggatcgatcggaggaagggaaggcggagcagcggtgatggggaaggcggcggcggtggggacggcggtggtggtggccgcggcggtcggggtggcggtggtgctggcgcggaggcggaggaggagggacctggagctggtggagggagccgcggcggagaggaagaggaaggtggcggcggtgatcgaggacgtggagcacgcgctgtcgaccccgacggcgctgctgcggggcatctcggacgccatggtcaccgagatggagcgaggcctgcgcggggacagccacgccatggttaagatgctcatcacctacgtcgacaacctccccaccgggtaagcgcctcgattccgatctgatgtctgattcctttcgtttttcgtattatgtttcctttcgtttttagtattatgggtttggaactttgtgatctaaaaagtttggaattgggaaaggtctcgtattgatgcgaatcgttcgggaacaaatctagtagtgacgcgcgtaaccgtgggaatttatctccgtgctctgattaggaccgactgaccttttgatgggatggtaggaaatgtgcgaattctttttatgatgtttgtacgaaaatcagattcccccgaaaattgcgcctagtggtgatccgaagagaatggaactataatctcccatttgatcttcatgtggttttggtgtctcgtattcgtgaattgggattttttttgtacgttccgatcgaagctagatcaatcctagctttgccaaacaatataagccatttgttataactgaaataagttatgtaaccacaaggaaacgcttgctctcggactctgctgaggagagccaaggcaaattggctcataccagtgattgaaggaaaaatgtggagtcgtgggcatctgaaattgcttctcatgcaccaggacgcaggatttcggtgatgggggtacagagttactaaagcatcatgcaatgagaaaaaaaatgaagtgctagtatgtgttattaacacaaacataaatcattgttatagaaaaaaatataaagtagccaagagaaaatgataatactcttgacaaggatgatttttgtgcttgaaaatgattgttttaatttagctgattgtgcatacacatactatacatacatgttatagattatagatcacatttgtttgctaaaacaatttgcggggtaccggattacgaactgtacccctcatgtccttgtgtaaacaggattctacatagaactcaaacaagatagataaattggcctatctaagctaggaaagataggtctcccgtcaacatatcctatcgttctcagatgatcttcggttttgtgatctatagtagatcgtccatttgttcctaatttggctctttaggatttctgattatgatatgtgattaattaatttgatcgtccatttgttcctactttggctctttaggatttctgattatgatatgtgattaattaatttcttgttggtttgatttgttaaggcttcagtgacaggtaattaactaatgtatggcagagagtttctttgcattgtggtttccttgttagcaatctgaccaattagatccatcagtcgagcttatctcatggtatagttggtctggtaataagtttctctgtaacctccacatcgttaagctaaatgtggcaggcacatcctgaaggaagtttcttaaatataatgattcattcttattctatcggatccttctaccagtctgttagaactcactcacccataagcatacaatgtttcctgctgccttcttccaaaagtagtaatttcattctttgatcataatgatttccctttgcagaaatgaacaggggttgttttatgcattggatcttggaggaaccaacttccgcgtcctgcgagtccaactcggtggcaaggagaaacgtgtcgtccaacaacagtacgaggaagtctcaattccaccacatctgatggttggaacttccatggtaagcatttgctgcttgattttaaatttcttggagctgtacattccatgcttgtcttatgtattttctgactattaatgcaggaactgtttgattttattgcttctgcattgtcaaaatttgttgatactgaaggtgatgatttccacctcccagaagggagacagagagagctgggcttcaccttttccttcccagtgagccagacatcaatatcgtcaggaacgctcatcaagtggacaaagggtttctccatcaatgacgcggtaaaagtcaaaaataacttttggacataccctgactagaacacaatcctgatccttctttaaacacatgaattatgtcacaaggttccttgataaagcttgattgaatatggcaatggagtatttcaattagctatttgctacaatctccctttgtgtacattgtaatcaacttaactaggttagtgaaaagaaatatcgaccttgatcaggaagcatatttaatttgaggatctttaatagtactcagtattatgtttgcctggttgatcatatctgtgtgaactgtcaagcatccaataagaataatttgattttgctatattatctcctgaattaggttggcgaagatgttgtatctgagttgggcaaggccatggagaggcagggattagatatgaaaattgcagcattggtaagttaatatatattaatttcgtcaatttcttacttccacactatatctatgctcagctccgttatctgaggcattgataatcatttgtatcctgatgctgcttttggggtattcacatctgatgatgtgatgcaaacattgttgacatgatttaccactgatgttaggttaatgacactgtcggcacattggctggtgggaggtatgcggataacagtgttgttgctgctataatattgggcactggtacaaatgcagcatatgttgagaatgctaatgcaattcctaaatggaccggtttactgcctaggtccggaaatatggttagtgtgtgaataccttatgcttgggattatcattagttgtctatgtcttatagatgatcaatgccaacactcttgaatgttaaccctacttaaaaaaatatgtaaacgtggaattatttggtattctctaggtaatcaacacagaatgggggagctttaaatcagataagcttcctctttcagaattcgataaagcaatggattttgaaagcttgaatcctggagagcaggtattctatccccagtattttcctctccttttagttttagccttttaggtggaccgcattaacttgtatgtattttccaacagatatatgaaaagttgatttctggcatgtatcttggagagatagtgcgaagaatcttgctgaagcttgctcatgatgcagctttgtttggggatgttgttccatctaagctagagcaaccgtttgtactaaggtatatttctgtaccatctctcttttgatcttcattccttccttttgtcatggcaaaagccgttttactttgttgttaactatcatgctggtcaagttttttttttcacgatttctgtgactaccccttggataagagtgcacatgatataaagacgttggcatcgtttccattataatattcgcactgttgataatatacccagatagattatggaaggggaagttgtttgtatatcttgaaattatcatgctaaatcagttagcaaatccatggaaggtgacaaacatacactttgttgttttatccattactactttcttctggttctggttgattctcataattgtgtgcaactagaagttatctagcttggataattagggtggtttggtttttgctcaccagtttttctttatgcttctaacccctcaatcttatgcaactctggtagaattttttataagtatctcaattgttgtatcacaggacaccggatatgtcagccatgcatcatgactcgtcacatgaccttaaaactgttggagctaagctaaaggatatcgtcggggtatgaaatttcttgacccaaagtggatacgcaacatccaacactgttcaatgagtactggttgcttatttatgatttgatcttttattcaggtcccagatacttccctggaagtaagatacattaccagtcacatttgtgacatagttgcagagcgtgctgcacgcttggctgctgctggcatatatggggtcctaaagaagctaggtcgggacaagatgccaaaagacggcagtaagatgcctaggactgtcattgccttggatggtgggctctatgaacattacaagaagttcagcagttgcttagaatcaactctaacagaccttcttggggatgatgtctcgtcttcggtggttaccaagctggccaacgatggttctggcattggagctgctcttctcgcagcctcgcactcccagtatgccgagatcgactagctttaaggatgatcttgatgaatgatgaatcaaactccgtttgtaggttctcatttcccccttcaaaatccacataatactcctggctccccccttgaaatcttaccatctttttttggctattctgagggcaaacataagtgcctctgcagcgggatatagctagtatagcgccaatgagtttggaggttttctaatggcataaaacgttggatggcagtagcagactaacagggaaatggaggcacaggcaatttccattcctgttctgtcagattcttttcccccttaattgatgttgagaaccaagatttttttgctctgtattttctcttcgtaataaagaaggggacataatctaattgctc</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0522500, RefSeq:Os05g0522500