Difference between revisions of "Os01g0785400"

From RiceWiki
Jump to: navigation, search
(Gene Family)
(Gene Family)
Line 6: Line 6:
  
 
===Gene Family===
 
===Gene Family===
The information on rice genomic sequence provides a powerful tool to identify putative homologous proteins by database searches with genes of known function from other organisms. The overall analysis of the complete genome of rice revealed that auxin-inducible GH3 gene family is comprised of 12 members. However, in A. thaliana, 19 GH3 genes, along with an additional partial gene (coding only for amino terminal third of the protein), have been reported.
+
The information on rice genomic sequence provides a powerful tool to identify putative homologous proteins by database searches with genes of known function from other organisms. The overall analysis of the complete genome of rice revealed that auxin-inducible GH3 gene family is comprised of 12 members(Table1). However, in A. thaliana, 19 GH3 genes, along with an additional partial gene (coding only for amino terminal third of the protein), have been reported.
 
[[File:GH3 gene family in rice.jpg]]
 
[[File:GH3 gene family in rice.jpg]]
  

Revision as of 15:31, 6 June 2014

Please input one-sentence summary here.

Annotated Information

Function

GH3 is one kind of early auxin-responsive genes that widely exists in numerous plants. GH3 belongs to the luciferase superfamily and contains highly conserved regions and variable regions. The GH3 proteins are classified into three groups on the basis of the protein structure and function, and group II GH3 genes encode IAA–amido synthetases, which help to maintain auxin homeostasis by conjugating excess IAA to amino acids. Previous studies showed that the GH3 proteins in Arabidopsis modulate multiple developmental processes including photo-morphogenesis, light and auxin signaling, and auxin homeostasis. In rice, GH3 proteins have been structurally analyzed and studies showed that OsGH3-2 participates in the microRNA-mediated auxin signal transduction pathway, OsGH3-8 maintains auxin homeostasis and functions in basal disease resistance, and OsGH3-13 regulates plant architecture and drought tolerance.[1]

Gene Family

The information on rice genomic sequence provides a powerful tool to identify putative homologous proteins by database searches with genes of known function from other organisms. The overall analysis of the complete genome of rice revealed that auxin-inducible GH3 gene family is comprised of 12 members(Table1). However, in A. thaliana, 19 GH3 genes, along with an additional partial gene (coding only for amino terminal third of the protein), have been reported. GH3 gene family in rice.jpg

Structure

Please input structure information here.

Expression

Please input expression information here.

Overexpression

Please input overexpression information here.

Mutation

Please input mutation information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

  1. Zhao S Q, Xiang J J, Xue H W. Studies on the Rice Leaf INCLINATION1 (LC1), an IAA–amido Synthetase, Reveal the Effects of Auxin in Leaf Inclination Control[J]. Molecular plant, 2013, 6(1): 174-187.

Structured Information

Gene Name

Os01g0785400

Description

GH3 auxin-responsive promoter family protein

Version

NM_001051002.1 GI:115440374 GeneID:4327043

Length

2486 bp

Definition

Oryza sativa Japonica Group Os01g0785400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:35064294..35066779

Sequence Coding Region

35064438..35064763,35064906..35065804,35065915..35066522

Expression

GEO Profiles:Os01g0785400

Genome Context

<gbrowseImage1> name=NC_008394:35064294..35066779 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:35064294..35066779 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgccggaagcaccgaccgccaagacagcaccggcctacggctacgcccccggggcgcacgccgaggcgctcgagttcatcgagcacgtcacggcgaacgccgggcaggtgcagcggcgcgtgctcggcgagatcctggcgcagaacgcgccggccgagtacctgcgccggtacggaatccccgggtcccccgacgttgtcgacgccttccgccgcctcgtcccgctcgtcacatacgagggcctccagccagacatcctccgcatcgccaacggcgacacctcgccgatcttctccgggaagcctatctccgaattcctcacgagctcgggcacgtcgggaggggagaggaagctcatgccgaccatcgccgacgagatgaacaggcggtcgctgctgtacagcctgctgatgccggtgatgagccagtcggtgtccgggctcgacaaaggcaaggcgatgtacctgctcttcgtgaaggcggagtcgcgcacgccgggcgggctcgcggcgcggccggtgctcacaagctactaccggagccggcagttcctcgaccgtccgcgcgacccctacacatcttacacgagccccgacgaggccatcctgtgcgtggactcctaccagagcatgtacgcgcagctgctctgcggcctcgtccaccgcgccgacgtgctgcgcgtgggcgccgtgttcgcctccggcttcctccgcgccatccatttcctcgagaagcactgggcgcgcctctgccacgacatccgcaccggcgagctcgacccggagatcaccgaccgcgtggtgcgcgacgccgtcgggcgggtgctccgcgccgacccggcgctcgccgacgcgatcgaggacgagtgcgctagggcgtcgtgggagggcatcatccggcgcctgtggccacgcaccaagtacatcgacgtgatcgtgaccggcaccatgtcgcagtacatcccgacgctcgagttctacggcggcggcctgccgctgacgtgcaccatgtacgcctcttcggagtgctacttcggcctcaacctgaatcccatgtgcaagcccagcgacgtcgcctacacgctcatccccaccatgtgctactacgagttcctccccgtcaattgcaacaatgccactgccgaggcgagccaccgcgacctcgtcgacctggtcgacgtaaagctcgggcacgagtacgagctcgtggtcaccacgtattccgggttgtatcgttatcgcgtgggcgacgtgctgagggtggcggggttcaagaacaaggccccgatgttcagcttcgtgcggcggcagaacgtggcgctgagcgtcgactcggacaagacggacgagacggagctgcacgcggcggtgagcggcgcggtgcagcacctggcgccgttcggcgcgtcgctggtggagtacacgagctacgcggacgcggccaccatcccgggccactacgtgctgttctgggagctgcgcgccggcagcacggcggtgccggcgtccgtgttcgaggagtgctgcctgtccgtggaggaggcactgaacagcgtctaccggcagggccgcgcgtgcgacaggtccatcggcccgctcgagatacgcgtcgtggcggagggcaccttcgacaagctcatggactacgcgatcagccggggcgcgtccatcaaccagtacaaggcgccgcggtgcgtgcgccctggcccggtcgtcgagctgctcgacgcgagggtgcagggcaagtacttcagtcccaagtgccccaagtggagccccgggaacaagcaatggaacaaaagcaaggatctggtcggcaagggagacgcctaa</cdnaseq>

Protein Sequence

<aaseq>MPEAPTAKTAPAYGYAPGAHAEALEFIEHVTANAGQVQRRVLGE ILAQNAPAEYLRRYGIPGSPDVVDAFRRLVPLVTYEGLQPDILRIANGDTSPIFSGKP ISEFLTSSGTSGGERKLMPTIADEMNRRSLLYSLLMPVMSQSVSGLDKGKAMYLLFVK AESRTPGGLAARPVLTSYYRSRQFLDRPRDPYTSYTSPDEAILCVDSYQSMYAQLLCG LVHRADVLRVGAVFASGFLRAIHFLEKHWARLCHDIRTGELDPEITDRVVRDAVGRVL RADPALADAIEDECARASWEGIIRRLWPRTKYIDVIVTGTMSQYIPTLEFYGGGLPLT CTMYASSECYFGLNLNPMCKPSDVAYTLIPTMCYYEFLPVNCNNATAEASHRDLVDLV DVKLGHEYELVVTTYSGLYRYRVGDVLRVAGFKNKAPMFSFVRRQNVALSVDSDKTDE TELHAAVSGAVQHLAPFGASLVEYTSYADAATIPGHYVLFWELRAGSTAVPASVFEEC CLSVEEALNSVYRQGRACDRSIGPLEIRVVAEGTFDKLMDYAISRGASINQYKAPRCV RPGPVVELLDARVQGKYFSPKCPKWSPGNKQWNKSKDLVGKGDA</aaseq>

Gene Sequence

<dnaseqindica>145..470#613..1511#1622..2229#cacaaaccaagctccataccgctgcctacatctctggttagtagccaccaaggtccaaggagtaacacgctccgtgagagaccgaaatccagggagcacaaattgcacatttgcaccaagcacactcgctgcagctgcagtgacatgccggaagcaccgaccgccaagacagcaccggcctacggctacgcccccggggcgcacgccgaggcgctcgagttcatcgagcacgtcacggcgaacgccgggcaggtgcagcggcgcgtgctcggcgagatcctggcgcagaacgcgccggccgagtacctgcgccggtacggaatccccgggtcccccgacgttgtcgacgccttccgccgcctcgtcccgctcgtcacatacgagggcctccagccagacatcctccgcatcgccaacggcgacacctcgccgatcttctccgggaagcctatctccgaattcctcacgaggtatagcacaatatataacgtgacatgttcatgcttccccgtgtgtgtacgcacgcacgctgctgcgtgcaaaacctagaaagacgtacgagttcatatctgtacagatcttcatgcaatggaatttcatcatgtccaccagctcgggcacgtcgggaggggagaggaagctcatgccgaccatcgccgacgagatgaacaggcggtcgctgctgtacagcctgctgatgccggtgatgagccagtcggtgtccgggctcgacaaaggcaaggcgatgtacctgctcttcgtgaaggcggagtcgcgcacgccgggcgggctcgcggcgcggccggtgctcacaagctactaccggagccggcagttcctcgaccgtccgcgcgacccctacacatcttacacgagccccgacgaggccatcctgtgcgtggactcctaccagagcatgtacgcgcagctgctctgcggcctcgtccaccgcgccgacgtgctgcgcgtgggcgccgtgttcgcctccggcttcctccgcgccatccatttcctcgagaagcactgggcgcgcctctgccacgacatccgcaccggcgagctcgacccggagatcaccgaccgcgtggtgcgcgacgccgtcgggcgggtgctccgcgccgacccggcgctcgccgacgcgatcgaggacgagtgcgctagggcgtcgtgggagggcatcatccggcgcctgtggccacgcaccaagtacatcgacgtgatcgtgaccggcaccatgtcgcagtacatcccgacgctcgagttctacggcggcggcctgccgctgacgtgcaccatgtacgcctcttcggagtgctacttcggcctcaacctgaatcccatgtgcaagcccagcgacgtcgcctacacgctcatccccaccatgtgctactacgagttcctccccgtcaattgcaacaatgccactgccgaggcgagccaccgcgacctcgtcgacctggtcgacgtaaagctcgggcacgagtacgagctcgtggtcaccacgtattccggtaaatctgccttacctcttcgacacataacgtggccgcgcgcgatggatgatatatattcttatatgcagtagtaatatatataattaacagttttgcgattgtgacagggttgtatcgttatcgcgtgggcgacgtgctgagggtggcggggttcaagaacaaggccccgatgttcagcttcgtgcggcggcagaacgtggcgctgagcgtcgactcggacaagacggacgagacggagctgcacgcggcggtgagcggcgcggtgcagcacctggcgccgttcggcgcgtcgctggtggagtacacgagctacgcggacgcggccaccatcccgggccactacgtgctgttctgggagctgcgcgccggcagcacggcggtgccggcgtccgtgttcgaggagtgctgcctgtccgtggaggaggcactgaacagcgtctaccggcagggccgcgcgtgcgacaggtccatcggcccgctcgagatacgcgtcgtggcggagggcaccttcgacaagctcatggactacgcgatcagccggggcgcgtccatcaaccagtacaaggcgccgcggtgcgtgcgccctggcccggtcgtcgagctgctcgacgcgagggtgcagggcaagtacttcagtcccaagtgccccaagtggagccccgggaacaagcaatggaacaaaagcaaggatctggtcggcaagggagacgcctaatattgaagctagagggtgatgatctgatcgagtatttgtgtgagctggtaattaattaacggtacatgcatatggtcattggtcgatatgtttctttagggatatgataattcatgtttgaattatctctgatgctgcgagaggatcgaatagttatgagatgacgacttagcctatatgatcatttgctttactctttctctgctgtaacgcagtatatgttatttcctccgtctcaaaatataagcatttttagt</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0785400, RefSeq:Os01g0785400