Difference between revisions of "Os03g0135700"

From RiceWiki
Jump to: navigation, search
(Expression)
(Evolution)
Line 10: Line 10:
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
The RAI1 protein has a bHLH domain that is conserved in homologous rice proteins . The basic domain at the N-terminus of bHLH is known to be important for binding to DNA elements such as the cis-elements in the promoters of target genes . The HLH domain includes two amphipathic a-helices with a linking loop. These a-helices may function in the formation of homodimers or heterodimers with other bHLH proteins .
 
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 16:30, 6 June 2014

Please input one-sentence summary here.

Annotated Information

Function

The Rac/Rop GTPase OsRac1 plays an essential role in rice immunity.the gene RAP1 encodes a putative basic helix–loop–helix transcription factor and thhis factor acts as the first factor downstream of the OsRac1,it can induce the expression of the PAL1 and OsWRKY19 by the mechanism of interacting with the OsMKK4–OsMAPK3/6 cascade,which result in the enhancement of the immunity to the rice blast fungus.

===Expression

We used fluorescent proteins to examine the subcellular localization of RAI1 in rice protoplasts isolated from cultured cells. The protoplasts were transfected with either a fluorescent RAI1–green fluorescent protein (GFP) construct or the control fluorescent protein GFP, and then examined under a confocal microscope. RAI1–GFP accumulated mainly in the nucleus but slightly in the cytoplasm, whereas GFP was distributed throughout the cytoplasm and nucleus.this implies that this gene may be a translation factor .when the rice was treated with the sphingolipid and chitin elicitors,we can observe the elevation of this gene's expression level ,and the response is more instant than the PAL1 and OsWRKY19 ,with the addition of other expeiments,we can conclude that this gene act as the first factor downstream of theOsRac1 and induce the expression of the PAL1 and OsWRKY19,two essential genes in the plant immunity.

Evolution

The RAI1 protein has a bHLH domain that is conserved in homologous rice proteins . The basic domain at the N-terminus of bHLH is known to be important for binding to DNA elements such as the cis-elements in the promoters of target genes . The HLH domain includes two amphipathic a-helices with a linking loop. These a-helices may function in the formation of homodimers or heterodimers with other bHLH proteins .

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os03g0135700

Description

Basic helix-loop-helix dimerisation region bHLH domain containing protein

Version

NM_001055424.2 GI:297600285 GeneID:4331538

Length

1998 bp

Definition

Oryza sativa Japonica Group Os03g0135700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:1961902..1963899

Sequence Coding Region

1961902..1962100,1962234..1962310,1962516..1962686,1962871..1963047,1963190..1963819

Expression

GEO Profiles:Os03g0135700

Genome Context

<gbrowseImage1> name=NC_008396:1961902..1963899 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:1961902..1963899 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagcttgacgaggagtccttcttggatgagctcatgtcgctgcggcgtgatggatcggcgccgtggcaggcgccgccgtacccgggtggcggcggcggcggcggcggtggcggcatgatgatgagtgacctcctcttctacggcggcgacggcggcagcgcggaggcgaggggcgggatggacgcgtcgccgttccaggagctggcgtccatggcggcgccgccgcctcagcatccgcacgaggagttcaacttcgactgcttgagcgaggtctgcaacccgtaccgcagctgcggcgcccagctcgtcccctcggaggcggctagccagacgcagacgcagctcactcctctccgcgacgcaatggtggcggaggaggagacgagcggcgacaaggcgctgctccatggcggcggcggctcgtcgtcgccgacgttcatgtttggaggtggcgccggagagagctcggagatgatggccggcatcagaggcgtcggcggcggcgtccacccgcggagcaagctccacggcacgccgtcgaagaacctcatggccgagaggcggcgtcgcaagcggctcaacgaccggctgtccatgctccggtccatcgtgcccaagattagcaagatggacaggacctcgatccttggtgacaccatcgactacgtgaaggagctgacggagaggatcaaaaccctcgaggaggagatcggcgtcacgccggaggagctcgacctgttgaacacgatgaaggattcctccagcggcaacaacaacgagatgctcgtgaggaattccaccaagttcgatgtcgagaaccggggcagcgggaacacgaggatcgagatatgctgcccggcgaaccccggcgtgctgctgtcgacggtgagcgcgctggaggtgctggggctagagatcgagcagtgcgtcgtgagctgcttcagtgactttggcatgcaggcctcctgcttacaagaggacgggaagaggcaagttgtcagcaccgacgagatcaagcagacattgttcaggagcgcaggctatggcggaaggaattatagtagatcgagtaccatttatgagttcatattcatcagcagtggtagtacctcgtttctgaacacaccagagagcaaattaaagatttgctcaagtattgtaagctttgcatttgtgaatcggtatgggaaccggccgtgtgatttgtcgaacattggatttgaattaaacgccaaggtaccaattgtttgt</cdnaseq>

Protein Sequence

<aaseq>MELDEESFLDELMSLRRDGSAPWQAPPYPGGGGGGGGGGMMMSD LLFYGGDGGSAEARGGMDASPFQELASMAAPPPQHPHEEFNFDCLSEVCNPYRSCGAQ LVPSEAASQTQTQLTPLRDAMVAEEETSGDKALLHGGGGSSSPTFMFGGGAGESSEMM AGIRGVGGGVHPRSKLHGTPSKNLMAERRRRKRLNDRLSMLRSIVPKISKMDRTSILG DTIDYVKELTERIKTLEEEIGVTPEELDLLNTMKDSSSGNNNEMLVRNSTKFDVENRG SGNTRIEICCPANPGVLLSTVSALEVLGLEIEQCVVSCFSDFGMQASCLQEDGKRQVV STDEIKQTLFRSAGYGGRNYSRSSTIYEFIFISSGSTSFLNTPESKLKICSSIVSFAF VNRYGNRPCDLSNIGFELNAKVPIVC</aaseq>

Gene Sequence

<dnaseqindica>1800..1998#1590..1666#1214..1384#853..1029#81..710#ggagaggtgactgctagcgaggaaagggagcatatatactactatagcttagcttgctgcaggtgctagctagctgaggcatggagcttgacgaggagtccttcttggatgagctcatgtcgctgcggcgtgatggatcggcgccgtggcaggcgccgccgtacccgggtggcggcggcggcggcggcggtggcggcatgatgatgagtgacctcctcttctacggcggcgacggcggcagcgcggaggcgaggggcgggatggacgcgtcgccgttccaggagctggcgtccatggcggcgccgccgcctcagcatccgcacgaggagttcaacttcgactgcttgagcgaggtctgcaacccgtaccgcagctgcggcgcccagctcgtcccctcggaggcggctagccagacgcagacgcagctcactcctctccgcgacgcaatggtggcggaggaggagacgagcggcgacaaggcgctgctccatggcggcggcggctcgtcgtcgccgacgttcatgtttggaggtggcgccggagagagctcggagatgatggccggcatcagaggcgtcggcggcggcgtccacccgcggagcaagctccacggcacgccgtcgaagaacctcatggccgagaggcggcgtcgcaagcggctcaacgaccggctgtccatgctccggtccatcgtgcccaagattagcaaggtgacacacacattgatttgtattgttgtcttgtgacctaattaattgacctagctagctgtagctagcttcttgtctccgtgtcccgtgtgctcatatatctgtaattaaacaatcaatcaatcgctcgctcgcgctgcagatggacaggacctcgatccttggtgacaccatcgactacgtgaaggagctgacggagaggatcaaaaccctcgaggaggagatcggcgtcacgccggaggagctcgacctgttgaacacgatgaaggattcctccagcggcaacaacaacgagatgctcgtgaggaattccaccaaggtacgtacctagcttagctacgcaggcaagcatcgcatcgatggagttttagtttggcatgtatgtatgtgcttgtatatttcttgtgcgtccgcgcagctaaattaatctggttgttgcgatcgaactttgtgatgcatggggcgaaactaactaattaaactgcggtttgattttcctccagttcgatgtcgagaaccggggcagcgggaacacgaggatcgagatatgctgcccggcgaaccccggcgtgctgctgtcgacggtgagcgcgctggaggtgctggggctagagatcgagcagtgcgtcgtgagctgcttcagtgactttggcatgcaggcctcctgcttacaagtaagttctatatatctatcttgaattcttgatagctatagcaacttagctagtgcggatttctgaacatctatatcggtcgatatatagctataccttgatttcttgctcgaacaaattaacctatagctatatataggcatatatatgttttgattaatctcttgtttcaatattgaatgggttcgtcgacaatgcatgataggaggacgggaagaggcaagttgtcagcaccgacgagatcaagcagacattgttcaggagcgcaggctatggcggaaggtgtctgtagctagctagctatacaatccattgaacgctgagcactgtgagcaggtacaggttgcatatatatgatcttcatcatccatgatataggagtaatagctatacatgcatatgcacttcgctccaggaattatagtagatcgagtaccatttatgagttcatattcatcagcagtggtagtacctcgtttctgaacacaccagagagcaaattaaagatttgctcaagtattgtaagctttgcatttgtgaatcggtatgggaaccggccgtgtgatttgtcgaacattggatttgaattaaacgccaaggtaccaattgtttgt</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0135700, RefSeq:Os03g0135700