Difference between revisions of "Os03g0307800"

From RiceWiki
Jump to: navigation, search
(Function)
(Expression)
Line 9: Line 9:
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
So far, 14 rice SET-domain-containing genes can be found in the SMART database, but in contrast to the two putative OsCLFs(AP005813; AP003044), the other 11 putative SET-containing genes have low sequence similarity with OsSET1 even in the SET domain.The detailed sequence analysis revealed that the OsSET1 gene has all known conserved regions, e.g. SET-N and SET-C in the SET domain, but lacks post-SET (Fig.1). Similar to other plant SET-domain-containing genes such as CLF and MEZ1-3, OsSET1 only has a cysteine-rich region, no pre-SET domain. Based on the sequence characteristics, the OsSET1 could be grouped into theSET1 family.
 +
[[File:haolt-F1.large.jpg]]
 +
The expression pattern of OsSET1 was similar to that of the SET-domain-containing genes investigated in Arabidopsis and maize in terms of lacking organ specificity (data not shown). A transient expression assay revealed that the fusion protein of OsSET1 and green fluorescent protein (GFP) was located in the nuclei (Fig.2).This was also similar to other SET-containing proteins such as E(z)and CLF. To investigate the function of the OsSET1 gene, a series of transgenic Arabidopsis and rice lines were constructed. Among them, about 53.8% transgenic Arabidopsis that over-expressed the SET domain resulted in altered shoot development shown in Fig.3B,as well as large cotyledons (Fig.3A,B). No tunic-corpus structure was observed in the sections of the shoot apex of transgenic plants with abnormal shoots (Fig.3D). Further investigation on the function of the OsSET1 is still being undertaken<ref name="ref1" />.
 +
[[File:haolt-F2.large.jpg]][[File:haolt-F3.large.jpg]]
  
 
===Evolution===
 
===Evolution===

Revision as of 16:40, 6 June 2014

Please input one-sentence summary here.

Annotated Information

Function

A novel SET-domain-containing gene OsSET1 was isolated from rice (Oryza sativa L.). Its deduced protein consists of 895 amino acids. OsSET1 has a high degree of structure similarity to other SET-domain-containing genes such as CLF in higher plants and E(z) in animals[1].

The SET domains are conserved amino acid sequences present in chromosomal proteins that contribute to the epigenetic control of gene expression by altering regional organization of the chromatin structure. The SET domain proteins are divided into four subgroups as categorized by their Drosophila members; enhancer of zeste (E(Z)), trithorax (TRX), absent small or homeotic 1 (ASH1) and supressor of variegation (SU(VAR)3–9). Homologs of all four classes have been characterized in yeast, mammals and plants. We report here the isolation and characterization of rice (Oryza sativa L. subspecies indica) cDNA, OsiEZ1, as a monocot member of this family. The OsiEZ1 cDNA is 3133 bp long with an ORF of 2799 bp, and the predicted amino acid sequence (895 residues) corresponds to a protein of ca. 98 kDa. All the characteristic domains known to be conserved in E(Z) homologs (subgroup I) of SET domain containing proteins are present in OsiEZ1. In the rice genome, a 7499 bp long OsiEZ1 sequence is split into 17 exons interrupted by 16 introns. Southern analysis indicates that OsiEZ1 is represented as single copy in the rice genome. Expression studies revealed that the OsiEZ1 transcript level was highest in rice flowers, almost undetectable in developing seeds of 1–2 days post-fertilization but increased significantly in young seeds of 3–5 days post-fertilization. The OsiEZ1 transcript was barely detectable in mature zygotic embryos, but its levels were significantly higher in callus derived from rice scutellum, somatic embryos and young seedlings. The OsiEZ1/GUS recombinant protein was confined to the nucleus in living cells of particle-bombarded onion peels. The expression of OsiEZ1 complemented a set1Δ Saccharomyces cerevisiae mutant that is impaired in telomeric silencing. We suggest that the nuclear-localized OsiEZ1 has a role in regulating various aspects of plant development, and this control is most likely brought about by repressing the activity of downstream regulatory genes [2].

Expression

So far, 14 rice SET-domain-containing genes can be found in the SMART database, but in contrast to the two putative OsCLFs(AP005813; AP003044), the other 11 putative SET-containing genes have low sequence similarity with OsSET1 even in the SET domain.The detailed sequence analysis revealed that the OsSET1 gene has all known conserved regions, e.g. SET-N and SET-C in the SET domain, but lacks post-SET (Fig.1). Similar to other plant SET-domain-containing genes such as CLF and MEZ1-3, OsSET1 only has a cysteine-rich region, no pre-SET domain. Based on the sequence characteristics, the OsSET1 could be grouped into theSET1 family. Haolt-F1.large.jpg The expression pattern of OsSET1 was similar to that of the SET-domain-containing genes investigated in Arabidopsis and maize in terms of lacking organ specificity (data not shown). A transient expression assay revealed that the fusion protein of OsSET1 and green fluorescent protein (GFP) was located in the nuclei (Fig.2).This was also similar to other SET-containing proteins such as E(z)and CLF. To investigate the function of the OsSET1 gene, a series of transgenic Arabidopsis and rice lines were constructed. Among them, about 53.8% transgenic Arabidopsis that over-expressed the SET domain resulted in altered shoot development shown in Fig.3B,as well as large cotyledons (Fig.3A,B). No tunic-corpus structure was observed in the sections of the shoot apex of transgenic plants with abnormal shoots (Fig.3D). Further investigation on the function of the OsSET1 is still being undertaken[1]. Haolt-F2.large.jpgHaolt-F3.large.jpg

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os03g0307800

Description

SET domain-containing protein

Version

NM_001056434.1 GI:115452596 GeneID:4332612

Length

7498 bp

Definition

Oryza sativa Japonica Group Os03g0307800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:11003001..11010498

Sequence Coding Region

11003231..11003419,11003494..11003571,11003663..11003791,11003880..11003927,11004018..11004108
,11004292..11004423,11004644..11004861,11005896..11006046,11006135..11006784
,11007490..11007561,11007713..11007760,11007880..11008017,11008136..11008220
,11008839..11008997,11009577..11009913,11010035..11010146,11010234..11010284

Expression

GEO Profiles:Os03g0307800

Genome Context

<gbrowseImage1> name=NC_008396:11003001..11010498 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:11003001..11010498 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgtcgtcctcgtccaaggcctccgattcctcttcccaacgccccaagcggccggatcaagggccgtcgggcaaggacgcggccggcctcgtcgcgctgcacgggaagctggcgcagctgaagcgtcaggtccaatccacccgcctcgccgcgatcaaggagagggtggaggcgaacaggaaggcgctgcaggtgcacacgtgcgctctgttcgacgtcgccgcggcggcggaggtggcgtcgcggggcgccgagggcggcaacgcgctgtcgcggggcgcggcggaggggcaccgcaggttcgtggggtgggactcggcgagcgggccgggggagagggagttggtgcatgtgcaggaggagaatctggtcgccgggacgctcgtgctctcgagctctggtggtagcggcgcctcgcataggaccgtcgtgcagcttgtgaagctgcctgtggtcgacaagattccgccctacaccacgtggatcttcctggacaaaaaccaaagaatggccgatgatcagtcagttggtaggaggagaatttactacgacccaattgtcaatgaggctctgatctgcagtgaaagtgacgatgatgttccagagccagaggaagagaaacatgttttcacagaaggagaagatcagctaatatggaaagctactcaagatcatgggttaagtcgagaggttttaaatgtcctctgccagtttgttgatgcaactccttcagaaattgaggaaagatcagaagttctttttgagaaatatgagaagcagtctcaatcttcttacaagacagatttgcaactttttcttgacaagaccatggatgtggctttagattcttttgataatctcttctgtcggagatgtttggtttttgattgccgtctccatgggtgctcccagaacttggtattccctagcgagaagcaaccatatggtcatgaacttgatgaaaacaagagaccgtgtggcgatcagtgctaccttcgaaggagagaagtatatcaagatacgtgcaatgatgaccgaaatgcttgtacaacatataatatggattcaagatcttcctcactcaaagttagtgctaccatattgtctgaatcagaagattcaaacagagatgaagataacatcaaatccacttctattgttgaaaccagcagatcaaaaataactaattctgaatatgctgacaaaagtgtgacaccacctcctggagatgcttctgaaactgaaaatgtgtcccctgacatgcccctaagaactttaggcaggcgtaagatttcaaagcatgcctccaagtctaacgatcattcacctgataaaaggcagaagatatatagctcaccgtttccttttgcaatgagtgtactgaacaagcaatctgttccagaaattggtgagacatgtccagattccatagaatctgcagttgatcaacttccaagtctggatgaccctaacaagaaaatttctaccaaagatatgtgtgctggaagcacaactaacactactgaaaatacattacgagataataataataatttgttcatctccaacaaggagcactctatttctcattggagtgctttagagagagatttgtacttgaagggaattgagatatttgggaaaaacagttgtctcatagctagaaacctattgtctggcctgaagacctgcatggaagtggccagctacatgtacaacaatggtgcggcaatggcaaagagacctctatctggtaaatccattttaggtgactttgcagaggctgaacaaggttacatggagcaagatttggtggcaaggacaagaatctgtcgtcgtaagggccgagctcgaaagctcaaatacacttggaagtctgcagggcatccaactgtaagaaaaagaatcggtgatggaaagcaatggtacactcagtataacccatgtgggtgtcagcaaatgtgtggcaaagattgcgcctgtgtggaaaatggaacttgttgcgagaagtactgcgggtgctcaaagagctgcaaaaataggtttagaggatgtcattgcgcaaaaagtcaatgcagaagcagacagtgcccgtgttttgctgccagtcgtgaatgtgatccagatgtttgcagaaactgctgggtgagctgcggagatggctcactaggtgagccactggcaagaggtgatggctatcagtgtggaaacatgaaactcctcttaaaacaacaacaacgtatattgcttggaaaatctgatgttgcgggttggggtgcattcattaagaacccagtaaatagaaatgattaccttggtgaatacactggcgaattgatttctcatagagaagcagataagcgtggcaaaatatatgatcgagcaaattcatcgttcctatttgatttaaatgagcagtatgtactggatgcttatcgcaagggggataaactgaagtttgcaaatcactcgtcgaatcctaactgctatgcgaaggttatgttggtggctggcgatcatcgagttggtatctatgcaaaggaccgcattgaggctagcgaggaactcttttatgattaccgctatggacctgaccaagccccagcttgggctaggagaccggaagggtcaaaaaaggatgaagcatctgtctctcaccaccgagcgcacaaagttgctagatag</cdnaseq>

Protein Sequence

<aaseq>MASSSSKASDSSSQRPKRPDQGPSGKDAAGLVALHGKLAQLKRQ VQSTRLAAIKERVEANRKALQVHTCALFDVAAAAEVASRGAEGGNALSRGAAEGHRRF VGWDSASGPGERELVHVQEENLVAGTLVLSSSGGSGASHRTVVQLVKLPVVDKIPPYT TWIFLDKNQRMADDQSVGRRRIYYDPIVNEALICSESDDDVPEPEEEKHVFTEGEDQL IWKATQDHGLSREVLNVLCQFVDATPSEIEERSEVLFEKYEKQSQSSYKTDLQLFLDK TMDVALDSFDNLFCRRCLVFDCRLHGCSQNLVFPSEKQPYGHELDENKRPCGDQCYLR RREVYQDTCNDDRNACTTYNMDSRSSSLKVSATILSESEDSNRDEDNIKSTSIVETSR SKITNSEYADKSVTPPPGDASETENVSPDMPLRTLGRRKISKHASKSNDHSPDKRQKI YSSPFPFAMSVLNKQSVPEIGETCPDSIESAVDQLPSLDDPNKKISTKDMCAGSTTNT TENTLRDNNNNLFISNKEHSISHWSALERDLYLKGIEIFGKNSCLIARNLLSGLKTCM EVASYMYNNGAAMAKRPLSGKSILGDFAEAEQGYMEQDLVARTRICRRKGRARKLKYT WKSAGHPTVRKRIGDGKQWYTQYNPCGCQQMCGKDCACVENGTCCEKYCGCSKSCKNR FRGCHCAKSQCRSRQCPCFAASRECDPDVCRNCWVSCGDGSLGEPLARGDGYQCGNMK LLLKQQQRILLGKSDVAGWGAFIKNPVNRNDYLGEYTGELISHREADKRGKIYDRANS SFLFDLNEQYVLDAYRKGDKLKFANHSSNPNCYAKVMLVAGDHRVGIYAKDRIEASEE LFYDYRYGPDQAPAWARRPEGSKKDEASVSHHRAHKVAR</aaseq>

Gene Sequence

<dnaseqindica>7080..7268#6928..7005#6708..6836#6572..6619#6391..6481#6076..6207#5638..5855#4453..4603#3715..4364#2938..3009#2739..2786#2482..2619#2279..2363#1502..1660#586..922#353..464#215..265#cggcggggtctcatccgattggaaacagattgggaagggggagggggtaggaatacgtggcgtcggcagtattaggtagagagagaaaccctttccatcctttgtctcttagccccgaaggagagagaaaaatcagaaaaaaaaaaccctccgcgtgtgggggaagcagagctccggacgctggcgccgctcgcgccaccgcacccgcaccgccatggcgtcgtcctcgtccaaggcctccgattcctcttcccaacgccccaaggtgcgcgccctcgcctcagtctcgactccccgcgcccgattccccactccgatctccttccccaatctgatcggcctcgctgtgcagcggccggatcaagggccgtcgggcaaggacgcggccggcctcgtcgcgctgcacgggaagctggcgcagctgaagcgtcaggtccaatccacccgcctcgccgcgatcaaggcaagcgcccgcccgccgatcacgcatctctacagtttcagctcgcagggggaagtgtgagtagtcggttggattttgctcaatctggcgtggattggtttggtttgtggtttttgagcaggagagggtggaggcgaacaggaaggcgctgcaggtgcacacgtgcgctctgttcgacgtcgccgcggcggcggaggtggcgtcgcggggcgccgagggcggcaacgcgctgtcgcggggcgcggcggaggggcaccgcaggttcgtggggtgggactcggcgagcgggccgggggagagggagttggtgcatgtgcaggaggagaatctggtcgccgggacgctcgtgctctcgagctctggtggtagcggcgcctcgcataggaccgtcgtgcagcttgtgaagctgcctgtggtcgacaagattccgccctacaccacgtggatcttcctggacaagtataatgcttctacacgctcattgttccaatcagatcacttgtcgctaggttcttgaacttgcagtttaagttttacaagagttcaggagaagttggtatattgccatgtaatacttcttaaataaaaagtagggtatgccatgtaatgcacctagatatgatattgtggaaaatatactactcaaaattcacttatgatgcatgaagcaaaattgaactatttacccatacaagccatagaaaccagacaacattttcagacagatattgcaaacttgggactagtagaaatatttggaatataagtgttagctcaaacattacactcaggtagtggtgttcatgtgtttttatgtttgctgatgagcgagagcactagtttgtgttaggatgatggtcagtttgaaaagattcagctacttgaacgatgtgtcatgctacttatcttcagtttatttgcttgattaattccaaagtggtatttattttctcatatacgtgctgcattggtgtaacaaagaatacttgatccctgttgtattcgatattttactctggtttaaacaacacagcgcagaaaccaaagaatggccgatgatcagtcagttggtaggaggagaatttactacgacccaattgtcaatgaggctctgatctgcagtgaaagtgacgatgatgttccagagccagaggaagagaaacatgttttcacagaaggagaagatcagctaatatggtaaaaacctggacattcaagaattctctctttttttttcattgaatatgctgtgatttttcccaatcatgatatctttctgttgcattttcttttcaataaaatgattcagatctaagttaaacatggaagaaggcccagagccatgaacttacattaacataacaaaccatccgtgcaaagttagttgcgctgtgcagttgttttactcagtctgcatgattaatccacctgttttctaccttaaggatcgtgcatactctaagagcttccaaccttcatgtaccctgttaattctgaaatgtaggtggaaggtaatgtgttgtattaaatcatctttttaggatggatcaacggatgccattttaatttaaccaatgcattattggtgaaatactggctggtttgactttacacttccagttgtgacaataatctgtaacccaagggcacccttcttttatttaccttttacacaatataatcagaataacaatttctattataaattatactggtaaaaatcggtaatcatcccaatactatccgctaccttcagaataaataaacatttttatatgtaaatttatgtctatctgatcttgcttaactatacaggaaagctactcaagatcatgggttaagtcgagaggttttaaatgtcctctgccagtttgttgatgcaactccttcagaaattgaggttgcccatttctcttttatgaacattttagttcgtcattactattttttttaactctgcagctgttttttattatcctacaatgtgatcatgactcttattccgatcaaaatactaggaaagatcagaagttctttttgagaaatatgagaagcagtctcaatcttcttacaagacagatttgcaactttttcttgacaagaccatggatgtggctttagattcttttgataatctcttctgtcggagatgtttggtatattatacttctggcattctgttgcttacagttcttttttgaattccatgttttaaacccctttgttcaactacattcgcaaggtctgaattacttgttgatatctatttattcaggtttttgattgccgtctccatgggtgctcccagaacttggtattccctgtaagtcataagttatttcctgttggactcttgtaaagttttgatctttctactttgctcatcctatcaatgaatggaggctgttgtcctgccatttggtccaaagtgaaattaaaaaaataccgctaactactaaccttttgcttaccagagcgagaagcaaccatatggtcatgaacttgatgaaaacaagagaccgtgtggcgatcagtgctaccttcgagtatgtgccccctcaagttttgcagttatatcaattaataaagttgtttatgattcctgaatttgcataatttgccagtccccccctgtgggaatctaagtttcactggtgtggaatattgagattgtattaaaaaaacttcgccaagatgtgtagttaatataagttttgccatcccagcagtgttgttcaaagaaatttcatagcctaggctttggttaaccgggtgtgagccttgaccagacctacatatacttctacaatattaaagcaataaattaggagtatattatttttctaatgaaaaatctaattaactttatgttgaagatatactattagatctgttgtcttgcttgttggacttcaggacccaaaagtagaccctccatacagtacatacactgttatgaactatggatcgtacaagtggcatcagagctaacaccatggcttctgtgggaagtactttttaaactatggtctcatttttctcctaaactccttcactcccattcggccatgctatctgatgtaacttttagtccgtatgcttatcaacattttcattgacccttttaatgggtttgattgatgcaacttctttagtttatttgtctattgaagcgagcctatgaattattctgagaattgcagcaattgctgcattgttgctaagactgattttgattaaaaaattcacagaggagagaagtatatcaagatacgtgcaatgatgaccgaaatgcttgtacaacatataatatggattcaagatcttcctcactcaaagttagtgctaccatattgtctgaatcagaagattcaaacagagatgaagataacatcaaatccacttctattgttgaaaccagcagatcaaaaataactaattctgaatatgctgacaaaagtgtgacaccacctcctggagatgcttctgaaactgaaaatgtgtcccctgacatgcccctaagaactttaggcaggcgtaagatttcaaagcatgcctccaagtctaacgatcattcacctgataaaaggcagaagatatatagctcaccgtttccttttgcaatgagtgtactgaacaagcaatctgttccagaaattggtgagacatgtccagattccatagaatctgcagttgatcaacttccaagtctggatgaccctaacaagaaaatttctaccaaagatatgtgtgctggaagcacaactaacactactgaaaatacattacgagataataataataatttgttcatctccaacaaggagcactctatttctcattggagtgctttagagagagatttgtacttgaagggaattgagatatttgggaaaaacaggtaattcttttatatttcccatgctatttgaaaatattgtttattgaaaaacgtaatttaattttaagttcataatggtatgccacagttgtctcatagctagaaacctattgtctggcctgaagacctgcatggaagtggccagctacatgtacaacaatggtgcggcaatggcaaagagacctctatctggtaaatccattttaggtgactttgcagaggctgaacaaggttacatggtacgtattgactggcctcgttaggttatgcttttatccagatcaaagaagtcaaaagaatctataactttggtagttatttttttctgaatgttttcagcacgtctgcattatagtggctgtatttggttgttgttcatcctcctgatatttagttctgtagtcgttatattatattaaatttctttcggcacccacaataaagatggacatggttctttttttggaaacaagcgtattgttcctaaaactggctagtgctagaattgtaggttgtctcatgttttcatatattaggtggttaggggaaattatattttattgtgaagtatagacaaattccaccggtcctataggtttgccttccttttttgcttctaagcacaccatctataacaatgtacaaaaaggagaaaaactgacaattcaatactccctccatctacttttgatagtcatattttcaaatctgaaaaatttatttttgataggcatatttcaatccaacaacatatcctcttaatgactttctcggatttaatgcgtgactctccattcttccacacaagattggctacatgggcatcgagaaatgtaaatattaatgaatcgcttgtttacgaggaatgactagtagcatgtttcaatagatgataagtagaattacttatccttggtctgtgtgccaagatgaaatatgactatcaaaagtagatggagggagtatttcatagtatttacagaaaacaaattgatctatggctagtatatgagtgcatgccaccgttttccatttgaaatcaagcctgttacttgttactactgtttacaatcgaaaaaccagttttcctgccttgtgccttcacagtttagttaagataatctcagtgctactgcacagttaaaagccaaaacacaaacatattttggcttcatttacaactgctatttttactccagtaacctaattgttgtcccagtttcaatcattattgttactccagtgacacaattatttactcatctctttgcaggagcaagatttggtggcaaggacaagaatctgtcgtcgtaagggccgagctcgaaagctcaaatacacttggaagtctgcagggcatccaactgtaagaaaaagaatcggtgatggaaagcaatggtacactcagtataacccatgtgggtgtcagcaaatgtgtggcaaagattgcgcctgtgtggaaaatggaacttgttgcgagaagtactgcgggtatgtcaagaaattttttattttccctttttgttgagtagaaatctgatttttcctttacttctcttatagaaatacttgtatgaacctgtgttgagctgtttgataaagaaatcaaattaaatacggtgtcaattcacttgtgcatttctgttttatgatcatgttagtgtaaagcaaaagcttgacgctcacttgttttaattattatcatcaacaggtgctcaaagagctgcaaaaataggtttagaggatgtcattgcgcaaaaagtcaatgcagaagcagacagtgcccgtgttttgctgccagtcgtgaatgtgatccagatgtttgcagaaactgctgggtgaggtaatcagcatgttgtgcacttaaggaccctcttgccctcgtattcaaggcaatacccatgctttgggatagtcttttaacagaaactaacaaaaatattgattggctatcatgtgctaatttattcagatttattttgtttaattaattacacgttacacgcatggcgtttattctcttcagctgcggagatggctcactaggtgagccactggcaagaggtgatggctatcagtgtggaaacatgaaactcctcttaaaacaacaacaacgtgtgagagctctagtcttgtattgcttgtttatctttccacatcattgtgctgtactatcttaactgcgttgtttgttgatcatggatcagatattgcttggaaaatctgatgttgcgggttggggtgcattcattaaggttagatcaatgaaaaagcacctttggatatgatgcattttgcattttggctaattccttttttttctttctttcttgcaacatgtagaacccagtaaatagaaatgattaccttggtgaatacactggcgaattgatttctcatagagaagcagataagcgtggcaaaatatatgatcgagcaaattcatcgttcctatttgatttaaatgagcaggtgtgaactaggtcttcatttctggccagttggagtgtcctgggtttgttaaaagtgaaacaggtaacctttatttgatgtgttcttgcagtatgtactggatgcttatcgcaagggggataaactgaagtttgcaaatcactcgtcgaatcctaactgctatgcgaaggtaatgacttatttttactgaatattcatcatgctctgttgcctttctcgttctgattccgtctgcccgtccaggttatgttggtggctggcgatcatcgagttggtatctatgcaaaggaccgcattgaggctagcgaggaactcttttatgattaccgctatggacctgaccaagccccagcttgggctaggagaccggaagggtcaaaaaaggatgaagcatctgtctctcaccaccgagcgcacaaagttgctagatagtccaacagcagctccagatgataatatcaactgtaaattataccgtcattgaaacacatagttcaatcctagtccattatacggccaatcgttggcataataagcatattctatattccttagttccttggtaaataaactgagatatcgagtatgcgaataaaagaaaaataaggcactgtaagtttatttgtacaaagtttggaatttatgctatgtatagttttgcc</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0307800, RefSeq:Os03g0307800

  1. 1.0 1.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2