Difference between revisions of "Os01g0968800"
| Line 9: | Line 9: | ||
===Evolution=== | ===Evolution=== | ||
| − | + | DREB/CBF is one prominent class of transcription factors, which binds to the stress responsive cis-acting elements. DREB/CBF belongs to the ERF(ethylene responsive element binding factors) family of transcription factors. And ERF proteins are a subfamily of the APETLA2 (AP2)/ethylene responsive element binding proteins (EREBP), which are characteristics of plants. The ERF family comprises two subfamilies, the EREBP (single AP2 domain) and AP2/family (two copies of AP2). The EREBP subfamily is further divided into two classes, i.e. ERFs and DREBs/CBFs. ERFs bind to the GCCbox found in the promoters of many pathogenesis-related (PR) genes conferring ethylene responsiveness, while DREBs/CBFs bind to the dehydration responsive element (DRE/CRT) in the promoters of cold and dehydration responsive LEA genes including rd29A, rd17, cor6.6, cor15a, erd10 and kin1. The DREBs/CBFs are further divided into two subclasses, DREB1/CBF and DREB2, induced by cold and dehydration stress respectively.<ref name="ref3"> | |
You can also add sub-section(s) at will. | You can also add sub-section(s) at will. | ||
| Line 17: | Line 17: | ||
==References== | ==References== | ||
| + | <references> | ||
| + | <ref name="ref1">Qiuyun Wang,Yucheng Guan,Yaorong Wu,Honglin Chen,Fan Chen,Chengcai Chu.(2008) Overexpression of a rice OsDREB1F gene increases salt, drought, and low temperature tolerance in both Arabidopsis and rice,Plant Molecular Biology, 67(6):589-602.</ref> | ||
| + | <ref name="ref2">Donghai Mao,Caiyan Chen.(2012) Colinearity and Similar Expression Pattern of Rice DREB1s Reveal Their Functional Conservation in the Cold-Responsive Pathway,PLoS ONE,7(10): e47275.</ref> | ||
| + | <ref name="ref3">Mohammad Sayyar Khan.(2011)THE ROLE OF DREB TRANSCRIPTION FACTORS IN ABIOTIC STRESS TOLERANCE OF PLANTS,Biotechnol.2433-2442</ref> | ||
| − | + | ||
| − | |||
| − | |||
==Structured Information== | ==Structured Information== | ||
Revision as of 03:08, 7 June 2014
OsDREB1F is a rice DREB transcription factor,which participates in rice responses to both abiotic and biotic stresses.
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
DREB/CBF is one prominent class of transcription factors, which binds to the stress responsive cis-acting elements. DREB/CBF belongs to the ERF(ethylene responsive element binding factors) family of transcription factors. And ERF proteins are a subfamily of the APETLA2 (AP2)/ethylene responsive element binding proteins (EREBP), which are characteristics of plants. The ERF family comprises two subfamilies, the EREBP (single AP2 domain) and AP2/family (two copies of AP2). The EREBP subfamily is further divided into two classes, i.e. ERFs and DREBs/CBFs. ERFs bind to the GCCbox found in the promoters of many pathogenesis-related (PR) genes conferring ethylene responsiveness, while DREBs/CBFs bind to the dehydration responsive element (DRE/CRT) in the promoters of cold and dehydration responsive LEA genes including rd29A, rd17, cor6.6, cor15a, erd10 and kin1. The DREBs/CBFs are further divided into two subclasses, DREB1/CBF and DREB2, induced by cold and dehydration stress respectively.Cite error: Closing </ref> missing for <ref> tag
[1]
[2]
Structured Information
| Gene Name |
Os01g0968800 |
|---|---|
| Description |
Similar to Dehydration responsive element binding protein 1F (DREB1F protein) |
| Version |
NM_001052056.1 GI:115442482 GeneID:4323832 |
| Length |
840 bp |
| Definition |
Oryza sativa Japonica Group Os01g0968800, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:44522272..44523111 |
| Sequence Coding Region |
44522341..44523000 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:44522272..44523111 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:44522272..44523111 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggacaccgaggacacgtcgtcggcttcgtcctcgtcggtgtcgccgccgtcgtcgccgggcggcgggcaccaccaccggctgccgccgaagcggcgggcggggcggaagaaattccgggagacgcggcacccggtgtaccgcggcgtgcgcgcgcgggcgggggggagcaggtgggtgtgcgaggtgcgcgagccgcaggcgcaggcgcgcatctggctcggcacctacccgacgccggagatggcggcgcgcgcgcacgacgtcgcggccatcgccctccgcggcgagcgcggcgccgagctcaacttcccggactccccctccacgctcccgcgcgcgcgcacggcgtcgcccgaggacatccgcctcgccgccgcgcaggccgccgagctgtaccgccgcccgccgccgccgctggcattgccggaggatccgcaggaaggcacgagcggcggcggcgccaccgccacctcggggcgtccggctgccgtgttcgtggacgaggacgccatcttcgacatgccggggctgatcgacgacatggcgagggggatgatgctgacgccgccggcgattgggagatctctcgacgactgggccgccatcgacgacgacgatgaccattaccacatggactacaagctatggatggactga</cdnaseq> |
| Protein Sequence |
<aaseq>MDTEDTSSASSSSVSPPSSPGGGHHHRLPPKRRAGRKKFRETRH PVYRGVRARAGGSRWVCEVREPQAQARIWLGTYPTPEMAARAHDVAAIALRGERGAEL NFPDSPSTLPRARTASPEDIRLAAAQAAELYRRPPPPLALPEDPQEGTSGGGATATSG RPAAVFVDEDAIFDMPGLIDDMARGMMLTPPAIGRSLDDWAAIDDDDDHYHMDYKLWM D</aaseq> |
| Gene Sequence |
<dnaseqindica>70..729#ccctcctctcatcgcaccaccacgccactgagctcaagctaagctaagtgctaacctaggtgttcgaccatggacaccgaggacacgtcgtcggcttcgtcctcgtcggtgtcgccgccgtcgtcgccgggcggcgggcaccaccaccggctgccgccgaagcggcgggcggggcggaagaaattccgggagacgcggcacccggtgtaccgcggcgtgcgcgcgcgggcgggggggagcaggtgggtgtgcgaggtgcgcgagccgcaggcgcaggcgcgcatctggctcggcacctacccgacgccggagatggcggcgcgcgcgcacgacgtcgcggccatcgccctccgcggcgagcgcggcgccgagctcaacttcccggactccccctccacgctcccgcgcgcgcgcacggcgtcgcccgaggacatccgcctcgccgccgcgcaggccgccgagctgtaccgccgcccgccgccgccgctggcattgccggaggatccgcaggaaggcacgagcggcggcggcgccaccgccacctcggggcgtccggctgccgtgttcgtggacgaggacgccatcttcgacatgccggggctgatcgacgacatggcgagggggatgatgctgacgccgccggcgattgggagatctctcgacgactgggccgccatcgacgacgacgatgaccattaccacatggactacaagctatggatggactgacatgtatacacacatatcgttcgagtatatatgcttacagatatagataatactccatcagttcctactaaatacggagtatatatttttagataaaggatttatataaaa</dnaseqindica> |
| External Link(s) |
- ↑ Donghai Mao,Caiyan Chen.(2012) Colinearity and Similar Expression Pattern of Rice DREB1s Reveal Their Functional Conservation in the Cold-Responsive Pathway,PLoS ONE,7(10): e47275.
- ↑ Mohammad Sayyar Khan.(2011)THE ROLE OF DREB TRANSCRIPTION FACTORS IN ABIOTIC STRESS TOLERANCE OF PLANTS,Biotechnol.2433-2442
