Difference between revisions of "Os03g0233900"
Wangjinlong (talk | contribs) (→Function) |
Wangjinlong (talk | contribs) (→Function) |
||
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | 1、Rice nsHb1 have hypothetical roles in nitrogen metabolism | |
| − | class 1 rice nonsymbiotic | + | The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb. |
| − | the hypothesis that plant | + | |
| + | 2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo | ||
| + | Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo . | ||
| + | |||
| + | 3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium | ||
| + | Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia. | ||
===Expression=== | ===Expression=== | ||
Revision as of 03:17, 7 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os03g0233900 |
|---|---|
| Description |
Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a) |
| Version |
NM_001056011.1 GI:115451750 GeneID:4332166 |
| Length |
1125 bp |
| Definition |
Oryza sativa Japonica Group Os03g0233900, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 3:7142189..7143313 |
| Sequence Coding Region |
7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008396:7142189..7143313 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008396:7142189..7143313 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq> |
| Protein Sequence |
<aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq> |
| Gene Sequence |
<dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica> |
| External Link(s) |