Difference between revisions of "Os03g0233900"

From RiceWiki
Jump to: navigation, search
(References)
(References)
Line 40: Line 40:
  
 
<ref name="ref1">
 
<ref name="ref1">
 +
 
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.
 
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.
 
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624
 
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624
 
</ref>
 
</ref>
 
<ref name="ref2">
 
<ref name="ref2">
 +
 
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.
 
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.
 
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175
 
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175
 
</ref>
 
</ref>
 
<ref name="ref3">
 
<ref name="ref3">
 +
 
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.
 
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.
 
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728
 
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728

Revision as of 04:54, 7 June 2014

Please input one-sentence summary here.

Annotated Information

Function

May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.

1、Rice nsHb1 have hypothetical roles in nitrogen metabolism

The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.

2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo

Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .

3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium

Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.

Expression

Protein names

Recommended name:Non-symbiotic hemoglobin 1; Alternative name(s):ORYsa、 GLB1a、 rHb1

Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.

Evolution

Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.

cd01040: globin [1]

Labs working on this gene

Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States

Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA

References

[1] [2] [3]

Structured Information

Gene Name

Os03g0233900

Description

Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)

Version

NM_001056011.1 GI:115451750 GeneID:4332166

Length

1125 bp

Definition

Oryza sativa Japonica Group Os03g0233900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:7142189..7143313

Sequence Coding Region

7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115

Expression

GEO Profiles:Os03g0233900

Genome Context

<gbrowseImage1> name=NC_008396:7142189..7143313 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:7142189..7143313 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>

Protein Sequence

<aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>

Gene Sequence

<dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0233900, RefSeq:Os03g0233900

  1. 1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions. Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624
  2. 2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins. Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175
  3. 3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins. Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728