Difference between revisions of "Os01g0968800"
| Line 6: | Line 6: | ||
===Expression=== | ===Expression=== | ||
| − | + | OsDREB1F was constitutively expressed in almost all the tissues and organs examined, including the young leaves, young roots, mature leaves, mature roots, young panicles and callus, and the expression is higher in panicles and callus than in the other tissues. | |
===Evolution=== | ===Evolution=== | ||
| − | DREB/CBF is one prominent class of transcription factors, which binds to the stress responsive cis-acting elements. DREB/CBF belongs to the ERF(ethylene responsive element binding factors) family of transcription factors. And ERF proteins are a subfamily of the APETLA2 (AP2)/ethylene responsive element binding proteins (EREBP), which are characteristics of plants. The ERF family comprises two subfamilies, the EREBP (single AP2 domain) and AP2/family (two copies of AP2). The EREBP subfamily is further divided into two classes, | + | DREB/CBF is one prominent class of transcription factors, which binds to the stress responsive cis-acting elements. DREB/CBF belongs to the ERF(ethylene responsive element binding factors) family of transcription factors. And ERF proteins are a subfamily of the APETLA2 (AP2)/ethylene responsive element binding proteins (EREBP), which are characteristics of plants. The ERF family comprises two subfamilies, the EREBP (single AP2 domain) and AP2/family (two copies of AP2). The EREBP subfamily is further divided into two classes, ERFs and DREBs/CBFs. ERFs bind to the GCCbox found in the promoters of many pathogenesis-related (PR) genes conferring ethylene responsiveness, while DREBs/CBFs bind to the dehydration responsive element (DRE/CRT) in the promoters of cold and dehydration responsive LEA genes including rd29A, rd17, cor6.6, cor15a, erd10 and kin1. The DREBs/CBFs are further divided into two subclasses, DREB1/CBF and DREB2, induced by cold and dehydration stress respectively<ref name="ref3"/>. |
| + | OsDREB1F was homologous to DREB or DREB-like TFs from other plants<ref name="ref1"/>. Colinearity analysis ofDREB1s from rice and Arabidopsis showed that each of the rice homologs possessed colinearity to Arabidopsis DREB1s to some extent<ref name="ref2"/>. | ||
You can also add sub-section(s) at will. | You can also add sub-section(s) at will. | ||
Revision as of 05:10, 7 June 2014
OsDREB1F is a rice DREB transcription factor,which participates in rice responses to both abiotic and biotic stresses.
Contents
Annotated Information
Function
Please input function information here.
Expression
OsDREB1F was constitutively expressed in almost all the tissues and organs examined, including the young leaves, young roots, mature leaves, mature roots, young panicles and callus, and the expression is higher in panicles and callus than in the other tissues.
Evolution
DREB/CBF is one prominent class of transcription factors, which binds to the stress responsive cis-acting elements. DREB/CBF belongs to the ERF(ethylene responsive element binding factors) family of transcription factors. And ERF proteins are a subfamily of the APETLA2 (AP2)/ethylene responsive element binding proteins (EREBP), which are characteristics of plants. The ERF family comprises two subfamilies, the EREBP (single AP2 domain) and AP2/family (two copies of AP2). The EREBP subfamily is further divided into two classes, ERFs and DREBs/CBFs. ERFs bind to the GCCbox found in the promoters of many pathogenesis-related (PR) genes conferring ethylene responsiveness, while DREBs/CBFs bind to the dehydration responsive element (DRE/CRT) in the promoters of cold and dehydration responsive LEA genes including rd29A, rd17, cor6.6, cor15a, erd10 and kin1. The DREBs/CBFs are further divided into two subclasses, DREB1/CBF and DREB2, induced by cold and dehydration stress respectively[1]. OsDREB1F was homologous to DREB or DREB-like TFs from other plants[2]. Colinearity analysis ofDREB1s from rice and Arabidopsis showed that each of the rice homologs possessed colinearity to Arabidopsis DREB1s to some extent[3].
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
- ↑ Mohammad Sayyar Khan.(2011)THE ROLE OF DREB TRANSCRIPTION FACTORS IN ABIOTIC STRESS TOLERANCE OF PLANTS,Biotechnol.2433-2442
- ↑ Qiuyun Wang,Yucheng Guan,Yaorong Wu,Honglin Chen,Fan Chen,Chengcai Chu.(2008) Overexpression of a rice OsDREB1F gene increases salt, drought, and low temperature tolerance in both Arabidopsis and rice,Plant Molecular Biology, 67(6):589-602.
- ↑ Donghai Mao,Caiyan Chen.(2012) Colinearity and Similar Expression Pattern of Rice DREB1s Reveal Their Functional Conservation in the Cold-Responsive Pathway,PLoS ONE,7(10): e47275.
Structured Information
| Gene Name |
Os01g0968800 |
|---|---|
| Description |
Similar to Dehydration responsive element binding protein 1F (DREB1F protein) |
| Version |
NM_001052056.1 GI:115442482 GeneID:4323832 |
| Length |
840 bp |
| Definition |
Oryza sativa Japonica Group Os01g0968800, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:44522272..44523111 |
| Sequence Coding Region |
44522341..44523000 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:44522272..44523111 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:44522272..44523111 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggacaccgaggacacgtcgtcggcttcgtcctcgtcggtgtcgccgccgtcgtcgccgggcggcgggcaccaccaccggctgccgccgaagcggcgggcggggcggaagaaattccgggagacgcggcacccggtgtaccgcggcgtgcgcgcgcgggcgggggggagcaggtgggtgtgcgaggtgcgcgagccgcaggcgcaggcgcgcatctggctcggcacctacccgacgccggagatggcggcgcgcgcgcacgacgtcgcggccatcgccctccgcggcgagcgcggcgccgagctcaacttcccggactccccctccacgctcccgcgcgcgcgcacggcgtcgcccgaggacatccgcctcgccgccgcgcaggccgccgagctgtaccgccgcccgccgccgccgctggcattgccggaggatccgcaggaaggcacgagcggcggcggcgccaccgccacctcggggcgtccggctgccgtgttcgtggacgaggacgccatcttcgacatgccggggctgatcgacgacatggcgagggggatgatgctgacgccgccggcgattgggagatctctcgacgactgggccgccatcgacgacgacgatgaccattaccacatggactacaagctatggatggactga</cdnaseq> |
| Protein Sequence |
<aaseq>MDTEDTSSASSSSVSPPSSPGGGHHHRLPPKRRAGRKKFRETRH PVYRGVRARAGGSRWVCEVREPQAQARIWLGTYPTPEMAARAHDVAAIALRGERGAEL NFPDSPSTLPRARTASPEDIRLAAAQAAELYRRPPPPLALPEDPQEGTSGGGATATSG RPAAVFVDEDAIFDMPGLIDDMARGMMLTPPAIGRSLDDWAAIDDDDDHYHMDYKLWM D</aaseq> |
| Gene Sequence |
<dnaseqindica>70..729#ccctcctctcatcgcaccaccacgccactgagctcaagctaagctaagtgctaacctaggtgttcgaccatggacaccgaggacacgtcgtcggcttcgtcctcgtcggtgtcgccgccgtcgtcgccgggcggcgggcaccaccaccggctgccgccgaagcggcgggcggggcggaagaaattccgggagacgcggcacccggtgtaccgcggcgtgcgcgcgcgggcgggggggagcaggtgggtgtgcgaggtgcgcgagccgcaggcgcaggcgcgcatctggctcggcacctacccgacgccggagatggcggcgcgcgcgcacgacgtcgcggccatcgccctccgcggcgagcgcggcgccgagctcaacttcccggactccccctccacgctcccgcgcgcgcgcacggcgtcgcccgaggacatccgcctcgccgccgcgcaggccgccgagctgtaccgccgcccgccgccgccgctggcattgccggaggatccgcaggaaggcacgagcggcggcggcgccaccgccacctcggggcgtccggctgccgtgttcgtggacgaggacgccatcttcgacatgccggggctgatcgacgacatggcgagggggatgatgctgacgccgccggcgattgggagatctctcgacgactgggccgccatcgacgacgacgatgaccattaccacatggactacaagctatggatggactgacatgtatacacacatatcgttcgagtatatatgcttacagatatagataatactccatcagttcctactaaatacggagtatatatttttagataaaggatttatataaaa</dnaseqindica> |
| External Link(s) |