Difference between revisions of "Os02g0666200"

From RiceWiki
Jump to: navigation, search
(Function)
(Expression)
Line 20: Line 20:
 
Transgenic rice plants with various OsPIP1 express level show that, appropriate low level of overexpressed OsPIP1 will increase seed yield, while high level of OsPIP1 expression will decrease seed yield, and extremely high expression will even make rice sterile.<ref name="ref1" />
 
Transgenic rice plants with various OsPIP1 express level show that, appropriate low level of overexpressed OsPIP1 will increase seed yield, while high level of OsPIP1 expression will decrease seed yield, and extremely high expression will even make rice sterile.<ref name="ref1" />
  
==Expression==
+
===Expression===
 
From the data in 2006, we can see ''OsPIP1'' is highly expressed in both the roots and leavels of rice, with transcript copy numbers more than 10^3.<ref name="ref2" />
 
From the data in 2006, we can see ''OsPIP1'' is highly expressed in both the roots and leavels of rice, with transcript copy numbers more than 10^3.<ref name="ref2" />
  

Revision as of 06:15, 7 June 2014

One of most highly expressed aquaporin gene in the leaves and roots of rice, highly responsible to environmental stresses.[1]

Annotated Information

Introduction

According to the nomenclature of PIP genes in maize, this gene has been designated as OsPIP1-1. PIP genes are the protein encoding genes of plasma membrane intrinsic proteins (PIPs) -- a subfamily of aquaporins that enable fast and controlled translocation of water across the membrane. There are recently 10 designated PIP genes in the gnome of rice, they are classified into two groups, that is OsPIP1-1 to OsPIP1-3 and OsPIP2-1 to OsPIP2-7, based on the similarity of their amino acid sequences.[2] The ubiquitously expression of OsPIP1-1 gene in rice leaves and roots indicates its important physiological role.

Function

Experiments show that when transiently expressed as EGFP-OsPIP1 in rice cell protoplasts, it is mainly distributed in cytoplasm, While co-expressing with EGFP-OsPIP1 make it re -translocate to plasma membrane. This observation is further confirmed by the water permeability measuring experiment.[1]

Seed germination

Transgenic rice seeds with overexpressed OsPIP1 exhibit a significant higher germination rate than the control, this is consistent with the higher α-amylase activity in transgenic seeds.[1]

Salt tolerance

Experiments show that when not overexpressed at high level,OsPIP1 will efficiently promote salt resistance in rice, but when has high OsPIP1 expression level, rice will become more sensitive to high salt environment than control.[1]

Seed yield

Transgenic rice plants with various OsPIP1 express level show that, appropriate low level of overexpressed OsPIP1 will increase seed yield, while high level of OsPIP1 expression will decrease seed yield, and extremely high expression will even make rice sterile.[1]

Expression

From the data in 2006, we can see OsPIP1 is highly expressed in both the roots and leavels of rice, with transcript copy numbers more than 10^3.[2]

Evolution

Aquaporin family occur in greatest numbers and with the greatest diversity in plants. Angiosperm species have ~30 different aquaporins grouped into four subfamilies: plasma membrane intrinsic proteins (PIPs), tonoplast intrinsic proteins (TIPs), nodulin 26-like intrinsic proteins (NIPs), and small, basic intrinsic proteins (SIPs). An EST library of the moss Physcomitrella patens reveals that its aquaporins fall into the same subfamilies, indicating that the main radiation of plant aquaporins was already established when land plant evolution began.[3]

The partial identification of Physcomitrella aquaporins demonstrates that the diversification into PIP, TIP, NIP and SIP subfamilies, as well as the differentiation into PIP1 and PIP2 classes, pre-dates the divergence of bryophytes and tracheophytes, whereas the differentiation of α-, γ- and δ-TIPs must have occurred during the evolution of tracheophytes. Identification of aquaporins in charophytes should elucidate to what degree the plant aquaporins had diversified before the algal ancestors invaded the land.[3]

Labs working on this gene

Please input related labs here.

References

<references> [1]

Structured Information

Gene Name

Os02g0666200

Description

Aquaporin

Version

NM_001054207.1 GI:115447784 GeneID:4330248

Length

3041 bp

Definition

Oryza sativa Japonica Group Os02g0666200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:27931202..27934242

Sequence Coding Region

27931313..27931649,27932641..27932936,27933296..27933436,27933924..27934019

Expression

GEO Profiles:Os02g0666200

Genome Context

<gbrowseImage1> name=NC_008395:27931202..27934242 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:27931202..27934242 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggaggggaaggaggaggacgtgcggctgggggcgaacaggtactcggagaggcagccgatagggacggcggcgcagggcgccggggacgacaaggactacaaggagccgccgccggcgccgctgttcgagccaggggagctcaagtcgtggtctttctaccgggccgggatcgccgagttcgtcgccaccttcctcttcctctacatcaccatcctcaccgtcatgggggtctccaagtcctcctccaagtgcgccaccgtcggcatccagggcatcgcctggtccttcggaggcatgatcttcgcgctcgtctactgcaccgccggcatctccggaggacacatcaacccagcagttacttttgggctgttcttggccaggaagctgtccctgacccgggccatcttctacatagtgatgcaatgcctaggggccatctgcggagctggagttgtgaagggcttccagcagggtctgtacatgggcaatggcggtggtgccaatgtagttgccagtggctacaccaagggtgacggtcttggtgctgagattgttggcaccttcatcctggtctacaccgtcttctcagccactgatgccaagaggaatgccagggactcacatgttcctatccttgccccactgccaattggttttgcggtgttcctggtccacctggccaccatccccatcaccggtactggcatcaacccagccaggagccttggcgctgccatcatctacaacaaggaccatgcctggaatgaccattggatcttctgggttggtcccttcgttggcgctgccctggctgccatctaccaccaggtgatcatcagggcgatcccattcaagagcaggtcttaa</cdnaseq>

Protein Sequence

<aaseq>MEGKEEDVRLGANRYSERQPIGTAAQGAGDDKDYKEPPPAPLFE PGELKSWSFYRAGIAEFVATFLFLYITILTVMGVSKSSSKCATVGIQGIAWSFGGMIF ALVYCTAGISGGHINPAVTFGLFLARKLSLTRAIFYIVMQCLGAICGAGVVKGFQQGL YMGNGGGANVVASGYTKGDGLGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPI GFAVFLVHLATIPITGTGINPARSLGAAIIYNKDHAWNDHWIFWVGPFVGAALAAIYH QVIIRAIPFKSRS</aaseq>

Gene Sequence

<dnaseqindica>112..448#1440..1735#2095..2235#2723..2818#ttcttcttcagtgtactctgcctttataacaccctactcctctctctcacctccaccatctagctcactcacacagtctccactcacacgcattgcagaggagaggcgacaatggaggggaaggaggaggacgtgcggctgggggcgaacaggtactcggagaggcagccgatagggacggcggcgcagggcgccggggacgacaaggactacaaggagccgccgccggcgccgctgttcgagccaggggagctcaagtcgtggtctttctaccgggccgggatcgccgagttcgtcgccaccttcctcttcctctacatcaccatcctcaccgtcatgggggtctccaagtcctcctccaagtgcgccaccgtcggcatccagggcatcgcctggtccttcggaggcatgatcttcgcgctcgtctactgcaccgccggcatctccggtcagttcactctcctttggcttcctcccccaccttcaagatctcaagtcttcaactttgtcatgattttgccttggtttgtcttgctagttgatacttacttgttacctgcactttgcttggctcagtagtttcttcatactagcatgctcactttagtaaagcatgaggtatagaatcatgtgtactactactgctccttccataagtagcaagactttgaggcatatggcattaacactgaataattgatgaaagacttttagttacctgcttttggggtgttagatcagtattagtaactggaaattcactaaatttgttgtccatgctcttgtagttttaaagaattattatagctttctacaggtgttgaatgcaccaaaaatttatgacactaccttttgctcttgtaccatcatgtaccttgtctgcgcaaagatttgtcgctggcatattgtactgctgtggtatgtgaattttgttcttatgcaaaggtttgatttacgactagaagattaaggatttaaggtcatccgattgatttaactcttaacccagcattttcttcggtagtgttctaactgttgatgctgaaaccacacaaattatcacacaaaaatatattatttttagttcatcaaaattgaatgtgcacttggagccttggaggcaaagaaatatgtgatgccaaaattttctccttggttaatcttcctaccagaatattaacaaaactatatgaacaagtaaatatcttgtgttgtcaacttatacagtctatcacaactcgcaatcttagaagttaatttctgtaccagttttatataatgcttcaaaatctcaaatactaccttgttaatctcaaaatatgaatacatgagggtacactatacagtcttacttcaactgtcatgacaactgaccacaaaacaactacggcaattaagggcactactaatatccattatattgtctgttactgcaacaggaggacacatcaacccagcagttacttttgggctgttcttggccaggaagctgtccctgacccgggccatcttctacatagtgatgcaatgcctaggggccatctgcggagctggagttgtgaagggcttccagcagggtctgtacatgggcaatggcggtggtgccaatgtagttgccagtggctacaccaagggtgacggtcttggtgctgagattgttggcaccttcatcctggtctacaccgtcttctcagccactgatgccaagaggaatgccagggactcacatgttcctgtaagtatccttctcctttttgcagtgtgatatgtgaaagttcagtagtagttagtgtggtctaatgagttatgcactgtgataactaattcatcaccaaaccctaaagtgataatgtgcaaatcactaagcagtattttggttagcacctttacatacctcactcatacagtatgcctttaacaatgaactggtgtgctcataacttgtaggtgtgcgccatttatggctagacttttaactagtttaatttatcatgtttgctcaagaaattgactgtatgcgtatagttactggaagtatatatgggttttttgtgtgttgcataacgtatttctgtcctttgttggtgaaaacagatccttgccccactgccaattggttttgcggtgttcctggtccacctggccaccatccccatcaccggtactggcatcaacccagccaggagccttggcgctgccatcatctacaacaaggaccatgcctggaatgaccatgtgagcaacctttcttctctttttacctactcgccgttctcagcaattggttcctcttacattatcagatattagtcagcacatcattgataatcgatacattttttgttggcaaattgaggtctaagctgataaacatgtcagtatatataatcaaatgttctcagcaattggttcctcttacattatcagatattagtcagcacattactgataatcgatacattttttgttggcaaattgaggtctaagctgataaacatgtcagtatatataatcaaatgttctgatactttttttggttatatttttctctttgtatgggtaggtctaagatgataaacatgtcactataaccaaatgtagcagcatgctcttgctaaagtttacttagtagcttaccagcttactagcctttgctcaagaaaagagtagaagacacgacaaagagtttttccttacaaattttggtatctaaattttgcagtggatcttctgggttggtcccttcgttggcgctgccctggctgccatctaccaccaggtgatcatcagggcgatcccattcaagagcaggtcttaagccccgcgccgccgctgcgcagccgacgacatgcaacgcaatcgtgatgtcctgtttcccgcgcgctactgctgcgcatctgtcgattccctctatctctagtccccaagatgtttttcctatctgaaccctgaacaactcaatcgtgtaatccagtactcagtcactgtatgtttttatgtgatggagatcttaattcttaagttatcatctctgttgctgg</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0666200, RefSeq:Os02g0666200

  1. 1.0 1.1 1.2 1.3 1.4 1.5 Liu C, Fukumoto T, Matsumoto T, Gena P, Frascaria D, Kaneko T, Katsuhara M, et al. (2013) Aquaporin OsPIP1;1 promotes rice salt resistance and seed germination. Plant Physiol Biochem.63:151-8.
  2. 2.0 2.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. 3.0 3.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref3