Difference between revisions of "Os04g0504000"

From RiceWiki
Jump to: navigation, search
(Function)
(Expression)
Line 6: Line 6:
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
 
 +
the gene, ''Os04g0504000'' encodes a putative a putative adenine phosphoribosyl transgerase (APRT). In plants, adenine phosphoribosyl transferase (APRT) is the primary enzyme that converts adenine into adenosine-5'-monophosphate( AMP) in the salvage metabolism pathway. The balance of adenosine triphosphate( ATP) in the cell is maintained by two biosynthetic pathways: ''de novo'' adenine biosynthesis and purine salvage pathway, adenine may be converted to AMP via two possible pathways" a single step pathway involving APRT activity and a two-step pathway involving the sequential action of adenosine phosphorylase and adenosine kinase( ADK). the single step APRT pathway is the predominant pathway for the salvaging of adenine in plants under stress conditions.In contrast to the ''de novo'' purine biosynthetic pathway, purine salvage is more efficient due to its ability to convert adenine, a byproduct of many biochemical reactions, into AMP.The mutant of the gene ''Os04g0504000'' is male sterile due to abortion of pollen development after the meiotic division of the pollen mother cell.and it is likely to be involved in TGMS in the rice line 'Annong S-1'.
  
 
===Evolution===
 
===Evolution===

Revision as of 07:32, 7 June 2014

Please input one-sentence summary here.

Annotated Information

Function

the rice gene, Os04g0504000,or named OsAPT2,contains seven exons and six introns.And it encodes a putative adenine phosphoribosyl transferase( APRT).The deduced amino acid sequence of Os04g0504000is highly homologous to those of previously isolated APRTs.The observed heat-induced change in the Os04g0504000expression pattern in young panicles may mediate, at least in part, thermo-sensitive genic male sterility( TGMS)in 'Annong S-1'.the Os04g0504000is likely to be involved in TGMS in the rice line 'Annong S-1'.

Expression

the gene, Os04g0504000 encodes a putative a putative adenine phosphoribosyl transgerase (APRT). In plants, adenine phosphoribosyl transferase (APRT) is the primary enzyme that converts adenine into adenosine-5'-monophosphate( AMP) in the salvage metabolism pathway. The balance of adenosine triphosphate( ATP) in the cell is maintained by two biosynthetic pathways: de novo adenine biosynthesis and purine salvage pathway, adenine may be converted to AMP via two possible pathways" a single step pathway involving APRT activity and a two-step pathway involving the sequential action of adenosine phosphorylase and adenosine kinase( ADK). the single step APRT pathway is the predominant pathway for the salvaging of adenine in plants under stress conditions.In contrast to the de novo purine biosynthetic pathway, purine salvage is more efficient due to its ability to convert adenine, a byproduct of many biochemical reactions, into AMP.The mutant of the gene Os04g0504000 is male sterile due to abortion of pollen development after the meiotic division of the pollen mother cell.and it is likely to be involved in TGMS in the rice line 'Annong S-1'.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os04g0504000

Description

Similar to Adenine phosphoribosyltransferase 2 (EC 2.4.2.7) (APRT)

Version

NM_001059779.1 GI:115459287 GeneID:4336327

Length

4794 bp

Definition

Oryza sativa Japonica Group Os04g0504000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:25564488..25569281

Sequence Coding Region

25564611..25564779,25564904..25565014,25566857..25566949,25567372..25567521,25568371..25568429
,25568526..25568582

Expression

GEO Profiles:Os04g0504000

Genome Context

<gbrowseImage1> name=NC_008397:25564488..25569281 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:25564488..25569281 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgggggaagaggatatcagcaacgacagcaagagcagctgcggctgcgaggacggcacggtggaggctccggcggctgcggcgccgaaggagaacggccgagccgcggacccgcgcctccaggccatctccgacgccatccgcgtcgtcccgcacttccccaagccagggatcatgttcaacgacatcacggcgctgctgctccggcccgccgcgttcaaggacgccgtggacatgttcgtcgagcgctaccgcggcatgcgcatcgcggccgtcgcaggtattgaagccagaggattcatatttggcccagcgatcgcactagcaattggagcaaaattcataccgttgcgcaaacctaagaaactcccaggtgaggtaatttctgagacctatatacttgagtatgggacggattgtttggagatgcatgttggagctactgaacctggtgagcgcgtagtggtcgttgatgatttagttgcaaccggtggaacactttgtgctgcaataaaacttcttgaacgagctggagctgacgtagttgagtgtgcatgcctcattggccttcctaagtataagaatttctacaagctcaatggaaaaccagtttatatactggtggagtctcgcaaatag</cdnaseq>

Protein Sequence

<aaseq>MGEEDISNDSKSSCGCEDGTVEAPAAAAPKENGRAADPRLQAIS DAIRVVPHFPKPGIMFNDITALLLRPAAFKDAVDMFVERYRGMRIAAVAGIEARGFIF GPAIALAIGAKFIPLRKPKKLPGEVISETYILEYGTDCLEMHVGATEPGERVVVVDDL VATGGTLCAAIKLLERAGADVVECACLIGLPKYKNFYKLNGKPVYILVESRK</aaseq>

Gene Sequence

<dnaseqindica>124..292#417..527#2370..2462#2885..3034#3884..3942#4039..4095#gatagccggaggaagaagaagaagcaacagcagcagtcaagccaacccgtccggcgagcaagaagcaaccgaggcagcaaaaggaggaggagggaggactccactgttcgcttgtatcgtcttatgggggaagaggatatcagcaacgacagcaagagcagctgcggctgcgaggacggcacggtggaggctccggcggctgcggcgccgaaggagaacggccgagccgcggacccgcgcctccaggccatctccgacgccatccgcgtcgtcccgcacttccccaagccaggtccgccgcccgtactcactagctagctaagctcgatcgatcgatgtcgaaaccgttttaagaccacgccaaatcagttgaccacgtgaaaccaagtcacgcgcggctctacgttaatttgcagggatcatgttcaacgacatcacggcgctgctgctccggcccgccgcgttcaaggacgccgtggacatgttcgtcgagcgctaccgcggcatgcgcatcgcggccgtcgcaggtaaacactataaacagccgtacgtccaagcactctcccaaccaaaccggtcaaaccatgatcctttgcgcggcgcctttgccctcgcgtcgccatgtgccggcggcgcggcgcggcgccgagcctgacaccaacgccgacggcgacggccgagccgagctgtgggactgaggcggcggtgttgtgagattccgtaatatctttgggggagatctttcctgctccttttgtccccctacgctttgtcgtttgatcaggtcatcatcccagtcaccacctgcagcaattttttcccctctcacctcctcctactatttctcaatataaacaatttttgcgataattaaactccggcagcatcagcagcggccgtgcgggcgcaacagtggtggtggtagaccggtaggtgcatgcgctgctgaactgtgacaactgtcgatacacgcacgtatgtcgaacataggagtactatactagtgtatcataggagtatgtctttctcgccgtctggtccagaggggcaataaatgcaggggccaatgcctccacgggccacggctgtggatggagcagccgcaggaaaggcgccgcgccgaggcggagaggagaatgccgatgcctccctgcaccgcacgctacgtactacgtgcgccgcgggcgcgggcgcatgtgggggatgtgcgtgtgcatccgtccgtccgtccgtgcgcgcgtggcgcgtagtagcgcggtggtactgtatggtccacggctgcgcgctccgaggcgccgatccgcgtgcgtgcgtgcggccagaatgtacgtacgcctcgtcgcgtcgcgtcgagcgagcgctcgctggttggctggcgcggctgcggctggctggctccgccgctcgcggggctccgctggggccagcggaatcttgggcgattcaatgcgcggatcggagccatgtacacggccggtgattgggtgggacgagagaaacaacaaacaacgagagatcgatcgatcgatcaacgcacggagagtcggagaggtcgcgattccttcctatgacacgctcggtggtagcaggctgggcagcggggagtcagttcggtctcttccctcggctgcgttgtggtgtggggtgagcggggaccggcccccagccgctctgtgggccggggatcccctccctcatcggacggccatgattgcgcacatgcggtgtcggaggtctcgctctctcccgtgtagtgtcgtcatctttggaacaatcacatgatggtttccgtttggttttgattctatgcagtgcaaactgagctcgctttcgctcagtgcatgtactgcacgacctcacgtttttcgttctagatgcaaaccggccgcgagtacaatgatctgatttttttagattgggagttggagtacagagtctgattagcttttcccggccgtgtgtgtttgctcgaagcactttactttcacggcattatggcgtttgttgtgacataaacctccaataattgaatagccatcgcaacgtcatcgtatttatactggctagttgaaagtttttactcctacaaggctacaatgaacatcgaacactgtgttgcaaaagtacatatggaagttctatcagggacgtttgctagtgatggatactttaaaattgtagatttctagtagtaaatttggtgggaaaaactgtagttctacgaaaaatttgatgttaaacatataactttgggatcttacatcttaaatttatagttttgtcaaatatgtgtgttttgtgaattttactgttataaatctaatttccatgtgtatatatatatggtgaaattctccaacttatgctaggtattgaagccagaggattcatatttggcccagcgatcgcactagcaattggagcaaaattcataccgttgcgcaaacctaagaaactcccaggtgaactacggactatgtcatttcgctcatacaaggagcatacctacatcctaaaacataaggaattttacccatatagtttacatgagtaaaatcccttatattttaggatgaatgtattaatttgtttactcgcacacagtacatttgcttccactgaaaatgctgtagcaacattatatatgtactactgctactactcatagaacctgttagcacatgaaccactcatcatgtcagctactgaaatagttatagcttgagtacactcaataaatgttgtttgaggatcattgaaatggtctgatgaatagaactgtagattttattccgctttggtactggtatacagctatatactacaaactcaatatagagttgctagtagaatgtgctaacagtggcttttacaaatcttaaaggtgaggtaatttctgagacctatatacttgagtatgggacggattgtttggagatgcatgttggagctactgaacctggtgagcgcgtagtggtcgttgatgatttagttgcaaccggtggaacactttgtgctgcaataaaacttcttggtgagtaactaaccgtttgtctcctcagcatgtatgcaaatgtaattcattgactgtggacaacactaaacaagtacgtacgtaagtgttaaaaaaatactattgttattttcagtttgctatgctctataatgctacttctaggtgacttatcatatgttttaacttctcaagtctgtcgaataataaaacacacattttaagctgaaaatttggttttcctgaacagataagcaatagaggaccttgagttatttaggatatttgctgactgttgtggaaaggatattctgatattttcttgtgataataacaaacattatattctgacttcaaaatgattcatattaaacgaaaatatcttaaatacatagtgccggacaaagaaagtgagagaaagtggaagaaaatggagtactgaatgtgtatatcatgtactactaatttagtaaaacatacaggacgtgaagctgaatatcatggatcatagtggagaagatcatgtaacattgtcaagcatcaaacagctcagtgataatatgtagagtagaggggcatcatgttctgttgaccttaagaaaagtatgctccccagtgagtcaacgggacaaactgtttattcatgggacaaaatcctgtccggaagatatgtcctattgggtggctaatcacctacatgcatgataagactggaggcataattttgatcttatcttacaaccgaaaagttcgtggataagaatcgagcattcaagaccctcccttttctctttttatgacactaaaacaactaactattctagtgtttacatctgtttatgcttattgctcaaactatttgcattccagaacgagctggagctgacgtagttgagtgtgcatgcctcattggccttcctaagtataaggtacactcatattttggttaagaaaattgagaatcgcatctcacttttaataccttgatcaattatttgcttactggacttgcatgttttatacagaatttctacaagctcaatggaaaaccagtttatatactggtggagtctcgcaaatagaaagtaacaaagcaatgatcaggcaagcatcacttttatgcttgaaattttctccaatatctccttttattttgataataatgtttgtaccatgttgtgcaatacagctaggctgcattattgtttgttcatggtcttttatcaatgcactgcttccatacacagtcgacatgagggtttaaaatgatgtgtactgttcttgacaagagtacacatgttgttaggtcctgacaattggtttataaaactttaaaatttctggatttttttatccgggtcagtgaaatattaatattgaaacgaggggcaaattgtgaatattgagcttctaattcatgtttccccctcctatcctttttcagaaagattcacagcttcattcctttgcaagagcacgttggaggaattggatcggtattggtgagcagtgactctgcacgcagcacaactgttaatgtaatctcggtggagagatgatgagatagatgaaatgtaatctttgtagcacgactagttttccaggtagtgtcgacgacgagagcttgtagttatttctgtcgggaactgttgattacccggaagagaaagggattaagggaattgccatcccgcttgttcagttcctcttttcttttctagtgacaattgtccttttcgccgcacttgatgatttatacttctttggtaaaactaccactc</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0504000, RefSeq:Os04g0504000