Difference between revisions of "Os01g0102300"
Happyharry (talk | contribs) (→Function) |
Happyharry (talk | contribs) (→Expression) |
||
| Line 6: | Line 6: | ||
===Expression=== | ===Expression=== | ||
| − | + | OsTLP27 was predicted to encode a thylakoid lumen protein of unknown function in chloroplast, and chloroplast targeting of OsTLP27 was confirmed by transient expression of a fusion protein with green fluorescent protein (GFP). OsTLP27 transcripts accumulated specifically in green tissues such as the leaf blade and leaf sheath, and the levels of its transcripts followed a circadian rhythm. Constitutive expression of OsTLP27 under the control of CaMV 35S promoter resulted in increased pigment content and enhanced photochemical efficiency in terms of the values of maximal photochemical efficiency of photosystem II (PSII) (Fv/Fm), effective quantum yield of PSII (ΦPSII), electron transport rate (ETR) and photochemical quenching (qP). Overexpression of OsTLP27 also enhanced transcript levels of genes related to chloroplast function and caused changes in the grana size and number. Further study showed that the structure and polypeptide composition of the photosynthetic apparatus were altered in transgenic lines overexpressing OsTLP27. These data suggested that OsTLP27 encodes a protein with a novel function in photosynthesis and chloroplast development in rice. | |
===Evolution=== | ===Evolution=== | ||
Revision as of 10:26, 7 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
The thylakoid lumen proteins are highly associated with photosynthesis functionally.
Expression
OsTLP27 was predicted to encode a thylakoid lumen protein of unknown function in chloroplast, and chloroplast targeting of OsTLP27 was confirmed by transient expression of a fusion protein with green fluorescent protein (GFP). OsTLP27 transcripts accumulated specifically in green tissues such as the leaf blade and leaf sheath, and the levels of its transcripts followed a circadian rhythm. Constitutive expression of OsTLP27 under the control of CaMV 35S promoter resulted in increased pigment content and enhanced photochemical efficiency in terms of the values of maximal photochemical efficiency of photosystem II (PSII) (Fv/Fm), effective quantum yield of PSII (ΦPSII), electron transport rate (ETR) and photochemical quenching (qP). Overexpression of OsTLP27 also enhanced transcript levels of genes related to chloroplast function and caused changes in the grana size and number. Further study showed that the structure and polypeptide composition of the photosynthetic apparatus were altered in transgenic lines overexpressing OsTLP27. These data suggested that OsTLP27 encodes a protein with a novel function in photosynthesis and chloroplast development in rice.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os01g0102300 |
|---|---|
| Description |
Conserved hypothetical protein |
| Version |
NM_001048282.1 GI:115433977 GeneID:4326466 |
| Length |
1140 bp |
| Definition |
Oryza sativa Japonica Group Os01g0102300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:133300..134439 |
| Sequence Coding Region |
133311..133615,133698..133824,133912..134253 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:133300..134439 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:133300..134439 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgacgtcatcattatcatcatccacagcctctgctgctgcttgttgcaagagtagaagtcgtaatcctcctccggcgccggcgccacacactagtactgcacgagtagttcgcagcagcaggcggaggcttctcttagtattcttctccgcagaggcggcggcggctgcgacgagcggtctcatccagaccccgtgtgggcaagcctaccctttcgctggcaccaacgtgaagaagccgcagccgccgtccaccccttactcccaatcccaatcgcagcagcagtttggcctcgacgccaaagggaggattagggcgtgcccgtcgacgaaccccggatgcgtgtccacaaaccccacggtgggcgcatcttgctccttggcctccccgctcatcgtccccgctaatacaccaacggacaaggccgccgcttcgctgcgcgaggctatcctcaagacgcagaggaatgcggtgatcaaagccgacgaggagacggcgtacgggcactacatccaggcggaggtcgacggcggcgcaggccgcgacgtgatggagttcctcctcaaggaatcccagtcccagtcccaggaggtggtggccgcgtaccgatgcgtcgccaccaaggtcatcttcgtctaccccttcaccactgccgtcggcgattcaagagggcagagccagaggatcgccgccgtcgcccaggagctcggatggtacgccccggacctactcaacgccgccaccgccgacgaccactctatcctcgactattaa</cdnaseq> |
| Protein Sequence |
<aaseq>MTSSLSSSTASAAACCKSRSRNPPPAPAPHTSTARVVRSSRRRL LLVFFSAEAAAAATSGLIQTPCGQAYPFAGTNVKKPQPPSTPYSQSQSQQQFGLDAKG RIRACPSTNPGCVSTNPTVGASCSLASPLIVPANTPTDKAAASLREAILKTQRNAVIK ADEETAYGHYIQAEVDGGAGRDVMEFLLKESQSQSQEVVAAYRCVATKVIFVYPFTTA VGDSRGQSQRIAAVAQELGWYAPDLLNAATADDHSILDY</aaseq> |
| Gene Sequence |
<dnaseqindica>12..316#399..525#613..954#gtacgtttgtaatgacgtcatcattatcatcatccacagcctctgctgctgcttgttgcaagagtagaagtcgtaatcctcctccggcgccggcgccacacactagtactgcacgagtagttcgcagcagcaggcggaggcttctcttagtattcttctccgcagaggcggcggcggctgcgacgagcggtctcatccagaccccgtgtgggcaagcctaccctttcgctggcaccaacgtgaagaagccgcagccgccgtccaccccttactcccaatcccaatcgcagcagcagtttggcctcgacgccaaagggtaattaactaaaccggccgccacagatctggatggatcgatcttaaaattaagaaagagattatatatattatggatgcaggaggattagggcgtgcccgtcgacgaaccccggatgcgtgtccacaaaccccacggtgggcgcatcttgctccttggcctccccgctcatcgtccccgctaatacaccaacggacaaggccgccgctgtaagtgtacgcacgcacgcatttgttattcatttaatatagcagtatttgtttctgaattagtaattcgatgtgaatgaatgacagtcgctgcgcgaggctatcctcaagacgcagaggaatgcggtgatcaaagccgacgaggagacggcgtacgggcactacatccaggcggaggtcgacggcggcgcaggccgcgacgtgatggagttcctcctcaaggaatcccagtcccagtcccaggaggtggtggccgcgtaccgatgcgtcgccaccaaggtcatcttcgtctaccccttcaccactgccgtcggcgattcaagagggcagagccagaggatcgccgccgtcgcccaggagctcggatggtacgccccggacctactcaacgccgccaccgccgacgaccactctatcctcgactattaaccaaggccatacatatgcttgcttcattatctctagtctgtacaagtacaactcgtccaaattcattcatccatccatccatccacgacacatatacaaatactaatctattattactactaagtagtactagtagccaccgatatatatacacaacaaatgtattaatcaaaatgctaatttatt</dnaseqindica> |
| External Link(s) |