Difference between revisions of "Os04g0572400"

From RiceWiki
Jump to: navigation, search
(Function)
(References)
Line 19: Line 19:
 
==References==
 
==References==
 
Please input cited references here.
 
Please input cited references here.
 
+
1. Donghai Mao;Caiyan Chen Colinearity and Similar Expression Pattern of Rice DREB1s Reveal Their Functional Conservation in the Cold-Responsive Pathway PLoS ONE, 2012, 7(10): e47275
1. Donghai Mao;Caiyan Chen
+
2. Jian-Qiang Chen;Xiu-Ping Meng;Yun Zhang;Mian Xia;Xi-Ping Wang Over-expression of OsDREB genes lead to enhanced drought tolerance in rice
  Colinearity and Similar Expression Pattern of Rice DREB1s Reveal Their Functional Conservation in the Cold-Responsive Pathway
 
  PLoS ONE, 2012, 7(10): e47275
 
2. Jian-Qiang Chen;Xiu-Ping Meng;Yun Zhang;Mian Xia;Xi-Ping Wang
 
  Over-expression of OsDREB genes lead to enhanced drought tolerance in rice
 
 
   Biotechnology Letters, 2008, 30(12): 2191-2198
 
   Biotechnology Letters, 2008, 30(12): 2191-2198
3. Xiu-Hong TIAN;Xue-Ping LI;Hua-Lin ZHOU;Jin-Song ZHANG;Zhi-Zhong GONG;Shou-Yi CHEN
+
3. Xiu-Hong TIAN;Xue-Ping LI;Hua-Lin ZHOU;Jin-Song ZHANG;Zhi-Zhong GONG;Shou-Yi CHEN OsDREB4 Genes in Rice Encode AP2-Containing Proteins that Bind Specifically to the Dehydration-Responsive Element Journal of Integrative Plant Biology, 2005, 47(4): 467-476
  OsDREB4 Genes in Rice Encode AP2-Containing Proteins that Bind Specifically to the Dehydration-Responsive Element
 
  Journal of Integrative Plant Biology, 2005, 47(4): 467-476
 
  
 
==Structured Information==
 
==Structured Information==

Revision as of 11:21, 7 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. The DREB transcription factors, which specifically interact with C-repeat/DRE (A/GCCGAC), play an important role in plant abiotic stress tolerance by controlling the expression of many cold or/and drought-inducible genes in an ABA-independent pathway. Transgenic rice plants analysis revealed that over-expression of OsDREB1G and OsDREB2B in rice significantly improved their tolerance to water deficit stress, while over-expression of OsDREB1E could only slightly improved the tolerance to water deficit stress, suggesting that the OsDREBs might participate in the stress response pathway in different manners.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here. 1. Donghai Mao;Caiyan Chen Colinearity and Similar Expression Pattern of Rice DREB1s Reveal Their Functional Conservation in the Cold-Responsive Pathway PLoS ONE, 2012, 7(10): e47275 2. Jian-Qiang Chen;Xiu-Ping Meng;Yun Zhang;Mian Xia;Xi-Ping Wang Over-expression of OsDREB genes lead to enhanced drought tolerance in rice

 Biotechnology Letters, 2008, 30(12): 2191-2198

3. Xiu-Hong TIAN;Xue-Ping LI;Hua-Lin ZHOU;Jin-Song ZHANG;Zhi-Zhong GONG;Shou-Yi CHEN OsDREB4 Genes in Rice Encode AP2-Containing Proteins that Bind Specifically to the Dehydration-Responsive Element Journal of Integrative Plant Biology, 2005, 47(4): 467-476

Structured Information

Gene Name

Os04g0572400

Description

Similar to CRT/DRE binding factor 1

Version

NM_001060143.1 GI:115460015 GeneID:4336721

Length

660 bp

Definition

Oryza sativa Japonica Group Os04g0572400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:29219354..29220013

Sequence Coding Region

29219354..29220013

Expression

GEO Profiles:Os04g0572400

Genome Context

<gbrowseImage1> name=NC_008397:29219354..29220013 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:29219354..29220013 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagtgggcgtactacggcagtgggtactcctcgtcggggacgccgtcgccggtgggcggcgacggggacgaggactcgtacatgacggtgtcgtcggcgccgcccaagcggcgggcggggaggaccaagttcaaggagacgaggcacccggtgtacaagggcgtgcgcagcaggaaccccgggaggtgggtctgcgaggtgcgcgagccgcacggcaagcagaggatctggctcggcaccttcgagaccgccgagatggcggcgcgcgcgcacgacgtcgcggcgatggcgctgcgcggccgcgccgcctgcctcaacttcgccgactcgccgcgcaggctccgcgtgccgccgctgggggccgggcacgaggagatacgccgcgccgcggtcgaggccgccgagctgttccgcccggcgcccgggcagcacaatgcggctgccgaggcggcggccgctgtcgctgcgcaggcaaccgcggcgagcgcggagctctttgccgacttcccttgctacccgatggacggactggaattcgaaatgcaggggtacctcgacatggcacagggaatgctcatcgagccgccgccattggcagggcaatcgacgtgggccgaggaggactacgactgcgaggtcaatctatggagctactga</cdnaseq>

Protein Sequence

<aaseq>MEWAYYGSGYSSSGTPSPVGGDGDEDSYMTVSSAPPKRRAGRTK FKETRHPVYKGVRSRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAAMALRGR AACLNFADSPRRLRVPPLGAGHEEIRRAAVEAAELFRPAPGQHNAAAEAAAAVAAQAT AASAELFADFPCYPMDGLEFEMQGYLDMAQGMLIEPPPLAGQSTWAEEDYDCEVNLWS Y</aaseq>

Gene Sequence

<dnaseqindica>1..660#atggagtgggcgtactacggcagtgggtactcctcgtcggggacgccgtcgccggtgggcggcgacggggacgaggactcgtacatgacggtgtcgtcggcgccgcccaagcggcgggcggggaggaccaagttcaaggagacgaggcacccggtgtacaagggcgtgcgcagcaggaaccccgggaggtgggtctgcgaggtgcgcgagccgcacggcaagcagaggatctggctcggcaccttcgagaccgccgagatggcggcgcgcgcgcacgacgtcgcggcgatggcgctgcgcggccgcgccgcctgcctcaacttcgccgactcgccgcgcaggctccgcgtgccgccgctgggggccgggcacgaggagatacgccgcgccgcggtcgaggccgccgagctgttccgcccggcgcccgggcagcacaatgcggctgccgaggcggcggccgctgtcgctgcgcaggcaaccgcggcgagcgcggagctctttgccgacttcccttgctacccgatggacggactggaattcgaaatgcaggggtacctcgacatggcacagggaatgctcatcgagccgccgccattggcagggcaatcgacgtgggccgaggaggactacgactgcgaggtcaatctatggagctactga</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0572400, RefSeq:Os04g0572400