Difference between revisions of "Os06g0127100"
(→Annotated Information) |
(→Expression) |
||
| Line 6: | Line 6: | ||
genotypes, which is consistent with previous reports that these DREBs/CBFs contribute to low temperature stress response by regulating many transcriptomic and metabolic changes. | genotypes, which is consistent with previous reports that these DREBs/CBFs contribute to low temperature stress response by regulating many transcriptomic and metabolic changes. | ||
===Expression=== | ===Expression=== | ||
| − | + | In the vegetative organs, the transcripts of the gene are found most abundant in the roots followed by the leaf and stem; whereas, in reproductive tissues,the gene expression is observed high in the embryo and lemma.It comprises a large group of plantspecific transcription factors and is involved in abiotic stress response. | |
===Evolution=== | ===Evolution=== | ||
Revision as of 12:14, 7 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
It comprises a large group of plantspecific transcription factors and is involved in abiotic stress response.It is highly up-regulated in both genotypes, which is consistent with previous reports that these DREBs/CBFs contribute to low temperature stress response by regulating many transcriptomic and metabolic changes.
Expression
In the vegetative organs, the transcripts of the gene are found most abundant in the roots followed by the leaf and stem; whereas, in reproductive tissues,the gene expression is observed high in the embryo and lemma.It comprises a large group of plantspecific transcription factors and is involved in abiotic stress response.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os06g0127100 |
|---|---|
| Description |
Similar to CBF-like protein |
| Version |
NM_001063196.1 GI:115466123 GeneID:4339974 |
| Length |
764 bp |
| Definition |
Oryza sativa Japonica Group Os06g0127100, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:1433771..1434534 |
| Sequence Coding Region |
1433798..1434442 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008399:1433771..1434534 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008399:1433771..1434534 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggagtactacgagcaggaggagtacgcgacggtgacgtcggcgccgccgaagcggccggcggggaggaccaagttcagggagacgaggcacccggtgtaccgcggcgtgcggcggcgggggcccgcggggcggtgggtgtgcgaggtcagggagcccaacaagaagtcccgcatctggctcggcaccttcgccaccgccgaggccgccgcgcgcgcccacgacgtcgccgcgctcgccctccgcggccgcggcgcgtgcctcaacttcgccgactcggcccgcctcctccgcgtcgacccggccaccctcgccacccccgacgacatccgccgcgccgccatcgagctcgccgagtcatgcccgcacgacgccgccgccgccgccgcctccagctccgccgccgccgtcgaggcctccgccgccgccgcgcccgccatgatgatgcagtaccaggacgacatggcggcgacgccgtccagctacgactacgcgtactacggcaacatggacttcgaccagccgtcctactactacgacgggatgggcggcggcggcgagtaccagagctggcagatggacggcgacgacgatggtggcgccggcggctacggcggcggcgacgtcacactctggagctactga</cdnaseq> |
| Protein Sequence |
<aaseq>MEYYEQEEYATVTSAPPKRPAGRTKFRETRHPVYRGVRRRGPAG RWVCEVREPNKKSRIWLGTFATAEAAARAHDVAALALRGRGACLNFADSARLLRVDPA TLATPDDIRRAAIELAESCPHDAAAAAASSSAAAVEASAAAAPAMMMQYQDDMAATPS SYDYAYYGNMDFDQPSYYYDGMGGGGEYQSWQMDGDDDGGAGGYGGGDVTLWSY</aaseq> |
| Gene Sequence |
<dnaseqindica>28..672#ccagcagcagcaacacacactactgacatggagtactacgagcaggaggagtacgcgacggtgacgtcggcgccgccgaagcggccggcggggaggaccaagttcagggagacgaggcacccggtgtaccgcggcgtgcggcggcgggggcccgcggggcggtgggtgtgcgaggtcagggagcccaacaagaagtcccgcatctggctcggcaccttcgccaccgccgaggccgccgcgcgcgcccacgacgtcgccgcgctcgccctccgcggccgcggcgcgtgcctcaacttcgccgactcggcccgcctcctccgcgtcgacccggccaccctcgccacccccgacgacatccgccgcgccgccatcgagctcgccgagtcatgcccgcacgacgccgccgccgccgccgcctccagctccgccgccgccgtcgaggcctccgccgccgccgcgcccgccatgatgatgcagtaccaggacgacatggcggcgacgccgtccagctacgactacgcgtactacggcaacatggacttcgaccagccgtcctactactacgacgggatgggcggcggcggcgagtaccagagctggcagatggacggcgacgacgatggtggcgccggcggctacggcggcggcgacgtcacactctggagctactgatgatcgcgagttggagctagcagttttgagctcaaccagctttgctcctcctatacagctaaatactgtaggagaaattaatggagattttt</dnaseqindica> |
| External Link(s) |
